PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN36664.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family G2-like
Protein Properties Length: 436aa    MW: 47674.5 Da    PI: 6.0517
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN36664.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like87.71.1e-27165219156
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                 k +++WtpeLH+rFv+aveqL G +kA+P++ile+m++++Lt+++++SHLQkYR++
  KHN36664.1 165 KVKVDWTPELHRRFVQAVEQL-GVDKAVPSRILEIMGIDCLTRHNIASHLQKYRSH 219
                 5689*****************.********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.042162221IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-26163222IPR009057Homeodomain-like
SuperFamilySSF466894.84E-18163222IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-26165219IPR006447Myb domain, plants
PfamPF002491.4E-7168217IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007165Biological Processsignal transduction
GO:0009658Biological Processchloroplast organization
GO:0009910Biological Processnegative regulation of flower development
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0010638Biological Processpositive regulation of organelle organization
GO:0045893Bi`s\vl VE`s\vl Vositive regulation of transcription, DNA-templated
GO:1900056Biological Processnegative regulation of leaf senescence
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 436 aa     Download sequence    Send to blast
MLAVSPLRST RDEGGQGEIL ESVSIGTDDF ADLSEGNLLE SINFDDFFMG INDDGDVLPD  60
LEMDPEMLAE FSLSTEDSEI ASSSVSVANN NNDGNNIVTT TEKQDDEVII IASNSSSDSG  120
SSQGEEIVSK SDESEVVVNP SPKESEKGRK SSNHASRNNN QGKRKVKVDW TPELHRRFVQ  180
AVEQLGVDKA VPSRILEIMG IDCLTRHNIA SHLQKYRSHR KHLLAREAEA ARWSQRKQLL  240
GAAGAGRGGG SKREVNPWLA PTMGFPPMTP MHHFRPLHVW GHHNMDQSFM HMWPKHPPYS  300
PSPPAWPPRT APSPPSPDPL YWHQHQLAPN APTTGTPCFP QPLTTTRFGS QTVPGIPPRH  360
AMYQIVDPGI GIPASQPPPR PLVDFHPSKE SIDAAISDVL SKPWLPLPLG LKAPALDGVM  420
GELQRQGIPK IPPSCA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A6e-16162217257ARR10-B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00022PBMTransfer from AT2G20570Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0955035e-92BT095503.1 Soybean clone JCVI-FLGm-19O16 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003543323.10.0PREDICTED: transcription activator GLK1-like isoform X1
SwissprotQ9SIV32e-98GLK1_ARATH; Transcription activator GLK1
TrEMBLA0A0B2RWR70.0A0A0B2RWR7_GLYSO; Transcription activator GLK1
STRINGGLYMA13G37010.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF42423461
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20570.19e-81GBF's pro-rich region-interacting factor 1
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]