PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN36585.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB_related
Protein Properties Length: 194aa    MW: 22494.2 Da    PI: 5.9044
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN36585.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.38.8e-193477146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     rg+++ eE+e +v+++++lG++ W++Ia++++ gRt++++k++w++
       KHN36585.1 34 RGNFSHEEEETIVRLHEKLGNR-WSAIAAELP-GRTDNEIKNHWHT 77
                     89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.3E-111439IPR009057Homeodomain-like
SuperFamilySSF466896.68E-221585IPR009057Homeodomain-like
PROSITE profilePS500904.0771528IPR017877Myb-like domain
PROSITE profilePS5129425.9432983IPR017930Myb domain
SMARTSM007171.1E-163381IPR001005SANT/Myb domain
PfamPF002494.9E-173477IPR001005SANT/Myb domain
CDDcd001678.42E-123677No hitNo description
Gene3DG3DSA:1.10.10.602.1E-224082IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 194 aa     Download sequence    Send to blast
MDLKGCPYST PRLARCGKSC RLRWLNYLRP DVKRGNFSHE EEETIVRLHE KLGNRWSAIA  60
AELPGRTDNE IKNHWHTALK KRFERKPKAK RRTEKEGNVV SKSMERVVLE NCSEYAVITT  120
DAAAAITNHE NSVLEGDDYG LSFLDTYTEP DVCANFWTEP YLIDNSYVPP EGDVVELWSH  180
NDLYMHEYCE GFFC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C3e-20148336105C-Myb DNA-Binding Domain
1msf_C3e-20148336105C-Myb DNA-Binding Domain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18087KRFERKPK
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN36585.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003541925.11e-133transcription factor MYB4
RefseqXP_028189328.11e-133transcription factor MYB4-like
TrEMBLA0A445IC991e-133A0A445IC99_GLYSO; Transcription factor MYB14
STRINGGLYMA13G37903.11e-132(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35633186
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.13e-39myb domain protein 15
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]