PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN36206.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family LBD
Protein Properties Length: 159aa    MW: 17906.6 Da    PI: 6.6207
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN36206.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26040.67.4e-13837130
      DUF260  1 aCaaCkvlrrkCakdCvlapyfpaeqpkkf 30
                +CaaCk+lrrkC+++Cv+apyfp ++p++ 
  KHN36206.1  8 PCAACKFLRRKCTQECVFAPYFPPDNPQRE 37
                7*********************99996543 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508919.0797122IPR004883Lateral organ boundaries, LOB
PfamPF031957.5E-11837IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0004088Molecular Functioncarbamoyl-phosphate synthase (glutamine-hydrolyzing) activity
Sequence ? help Back to Top
Protein Sequence    Length: 159 aa     Download sequence    Send to blast
MSSSSNSPCA ACKFLRRKCT QECVFAPYFP PDNPQREQQE MFRSYEHQQQ QEFLRFSGGG  60
FDMGSASSAG GFSQVSPAAA SADQLSPSLA LGSFDNAYHM QQPQQEEPHH HHHHPHHIPL  120
EAQLLLPPQQ KQQTHHESQL PLHQQHSDNE ERRSVGPSC
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN36206.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2351831e-153AC235183.1 Glycine max strain Williams 82 clone GM_WBb0008G09, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006573622.11e-62LOB domain-containing protein 36
RefseqXP_014631594.11e-62LOB domain-containing protein 36
RefseqXP_014631595.11e-62LOB domain-containing protein 36
RefseqXP_014631596.11e-62LOB domain-containing protein 36
TrEMBLI1J9473e-61I1J947_SOYBN; Uncharacterized protein
STRINGGLYMA01G39060.25e-62(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23533484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.17e-17ASYMMETRIC LEAVES 2-like 1
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]