PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN35655.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family HD-ZIP
Protein Properties Length: 327aa    MW: 36191.6 Da    PI: 7.99
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN35655.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox551.4e-17164218256
                 T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                 rk+ +++keq   Lee F+++ +++ +++  LAk+l+L  rqV vWFqNrRa+ k
  KHN35655.1 164 RKKLRLSKEQSAFLEESFKEHTTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTK 218
                 778899***********************************************98 PP

2HD-ZIP_I/II127.27.3e-41164254192
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                  +kk+rlskeq+++LEesF+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke +eLr +lk
   KHN35655.1 164 RKKLRLSKEQSAFLEESFKEHTTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELR-ALK 254
                  69*************************************************************************************9.555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.5E-17157223IPR009057Homeodomain-like
PROSITE profilePS5007117.151160220IPR001356Homeobox domain
SuperFamilySSF466898.13E-18161229IPR009057Homeodomain-like
SMARTSM003891.3E-15162224IPR001356Homeobox domain
CDDcd000861.01E-15164221No hitNo description
PfamPF000464.5E-15164218IPR001356Homeobox domain
PROSITE patternPS000270195218IPR017970Homeobox, conserved site
PfamPF021836.9E-11220254IPR003106Leucine zipper, homeobox-associated
SMARTSM003407.8E-26220263IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MELALSLGDT SKSFTFLDKA VTLPPNKDPP GFCLAPSFAE KRSDSERGTA SGSSDPPVQL  60
DLLPFSPVLR PQQHPPSHLR IPWLTQACGG AARVLDVNLF PAATAEDGDD GTSLSSSPNS  120
AVSPFQMDFC TRNGNAAEFG SRNKREQQEA EGRASDDDEN GSTRKKLRLS KEQSAFLEES  180
FKEHTTLNPK QKLALAKQLN LRPRQVEVWF QNRRARTKLK QTEVDCEYLK RCCETLTEEN  240
RRLQKELQEL RALKSSQPFY MQLPATTLTM CPSCERVATN STTTNQTSIV NNNASSQIPV  300
ELSLSKPRIL PFPNGQVQAQ AHQIASS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1162168TRKKLRL
2212220RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN35655.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150411e-100AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003533912.10.0homeobox-leucine zipper protein HOX11
RefseqXP_028179764.10.0homeobox-leucine zipper protein HOX11-like
SwissprotP466652e-86HAT14_ARATH; Homeobox-leucine zipper protein HAT14
TrEMBLA0A0B2RRA90.0A0A0B2RRA9_GLYSO; Homeobox-leucine zipper protein HAT14
TrEMBLI1L2K90.0I1L2K9_SOYBN; Uncharacterized protein
STRINGGLYMA09G16790.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23353382
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.11e-72homeobox from Arabidopsis thaliana
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]