PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN35390.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family LBD
Protein Properties Length: 179aa    MW: 20269.2 Da    PI: 6.2335
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN35390.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260125.32.9e-3915113199
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +CaaC++lrr+C ++Cvlapyfp ++  kfa vh++FGasnv+k+++ ++e++reda++++vyeA ar+rdPvyG++g i +lq+ +e+lka+l+++k+
  KHN35390.1  15 PCAACRMLRRRCDSKCVLAPYFPTNEVDKFAGVHRVFGASNVIKMIQMVEETKREDAVKAMVYEATARLRDPVYGSAGAIYQLQKMIEELKAQLESIKT 113
                 7*********************************************************************************************98876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.33114115IPR004883Lateral organ boundaries, LOB
PfamPF031951.4E-3915112IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0004088Molecular Functioncarbamoyl-phosphate synthase (glutamine-hydrolyzing) activity
Sequence ? help Back to Top
Protein Sequence    Length: 179 aa     Download sequence    Send to blast
MGFHCEEKDS IHLQPCAACR MLRRRCDSKC VLAPYFPTNE VDKFAGVHRV FGASNVIKMI  60
QMVEETKRED AVKAMVYEAT ARLRDPVYGS AGAIYQLQKM IEELKAQLES IKTRVSEQKD  120
QLLSIRNNNV NACGHLDQYP FPVNVDPIFD HDHLMVSDPF DFPVEGGGWV FSNMSTPSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-331511511111LOB family transfactor Ramosa2.1
5ly0_B2e-331511511111LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN35390.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150382e-52AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003553793.11e-134LOB domain-containing protein 1
RefseqXP_028217867.11e-134LOB domain-containing protein 1-like
SwissprotQ9SK085e-41LBD11_ARATH; LOB domain-containing protein 11
TrEMBLA0A0B2RQM41e-133A0A0B2RQM4_GLYSO; LOB domain-containing protein 11
TrEMBLK7N0C61e-133K7N0C6_SOYBN; Uncharacterized protein
STRINGGLYMA19G44645.11e-134(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF140681921
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.12e-43LOB domain-containing protein 11
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]