PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN35137.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB_related
Protein Properties Length: 948aa    MW: 104013 Da    PI: 4.5449
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN35137.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding31.54e-10795839146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+W+++E el+++av+++G++ ++ I +t+   +t+ q+k+++ k
       KHN35137.1 795 RGKWSKQETELFYEAVREMGTD-FSVIQKTFFPDKTRHQIKLKYKK 839
                      89********************.*******9889**********87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF159638.3E-22788857No hitNo description
PROSITE profilePS500906.26790841IPR017877Myb-like domain
SMARTSM007172.4E-8794843IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.0E-8795839IPR009057Homeodomain-like
SuperFamilySSF466891.64E-10796844IPR009057Homeodomain-like
CDDcd001676.44E-7797839No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 948 aa     Download sequence    Send to blast
MDPFDDILPT APAARTRLGA KFIPKAKSKQ FPRKGIPASE HSTSSKDGIS GNECQNAVAS  60
ALSMPAEEPK GSVHHTQVEI PNSEDSTNRK QVSVKGDSAA LVDDSTITAT EVDADQKSMN  120
FLKPICEVTE GDPVYFEGAS VTSFVPETNL NNGTTQPVHP ANAVENEFNV AAPSATCSAI  180
DRMKEQPKIG EGSFLDSNKL IDNSIQVGTD LGFQGSSDDK IAIIQSNFDS KSNFGKKQEG  240
VSAEFELDPF SNILPYPGAG NVHKFKPKIK PRPRVSNVPA IASDSSNVMM EKSVELPTSC  300
TNDFQFFQSC GDGSGGLNQS ASLPLPTSEI LRTTELPDKF DDTSSSILSE DNKSLAAAIP  360
SQLDSLNAML SEDAVHNGTT DWPSSFGKSS REAADIFSGL ESLDDFLTQA ATGTGKPALH  420
SFNGKGGEEN FVTPAPSSIN SFGECDTTQV QRCPEYHTPQ DSLTFNEAAV FNEDDIHTSN  480
RRLETEEIVD LNPACPGDDV IDYQSMKSGE DPTLGIPVHE ELTNAADSPT LADFLHADVT  540
REKEDSNKRK KDGSTSCSLR KNRRCIAGEE DKGAKTSRQL RKQAARKPAN SSLNEDVEDN  600
NDLDPSYNSN GDELQENDDE YEVDYPSRKR RVSNSSQKKP VAKSGKTSQK PKKANDDLEK  660
TEEPPKKFSH STRRRKRCVD KALLEIPEDE LDRLNIPIKD IILLEEHRER LAKKEAMTSN  720
TSSTNQSGGD SLHEAGSYNE GAYDDGAYDD GAYNDEEFLG SEDGRDPYDN QANEGITSTS  780
VLLNYQSFRE KKTPRGKWSK QETELFYEAV REMGTDFSVI QKTFFPDKTR HQIKLKYKKE  840
ERQQPLQLTD AVNNSAKDHP HSKLFIELLK LASTKAEEYP GRDASDLVMA EEVVDLTAGT  900
HEEVPKAATK KEDADVKAQE DSVAVPSPEQ SDDSDDDFQK WSQYKCGY
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN35137.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150431e-106AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028191523.10.0uncharacterized protein LOC114377281 isoform X3
TrEMBLA0A445HVC40.0A0A445HVC4_GLYSO; Uncharacterized protein
STRINGGLYMA11G01285.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36662938
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39160.13e-33MYB_related family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]