PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN35071.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB_related
Protein Properties Length: 80aa    MW: 9423.65 Da    PI: 9.14
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN35071.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding22.42.9e-072261445
                     S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                     ++++E++l+ +  k+ G + W++Ia +++  R ++++  +w 
       KHN35071.1 22 MSEQEEDLIRRMYKLVGDK-WNLIAGRIP-SRKAEEIERFWI 61
                     589**************99.*********.********9995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007176.0E-41866IPR001005SANT/Myb domain
CDDcd001671.60E-42260No hitNo description
Gene3DG3DSA:1.10.10.602.0E-92361IPR009057Homeodomain-like
SuperFamilySSF466891.4E-62361IPR009057Homeodomain-like
PfamPF002499.5E-72361IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009913Biological Processepidermal cell differentiation
GO:0010063Biological Processpositive regulation of trichoblast fate specification
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 80 aa     Download sequence    Send to blast
MSTTATTTSE EVSSNEWKVI HMSEQEEDLI RRMYKLVGDK WNLIAGRIPS RKAEEIERFW  60
IMRHGDAFSV KRHRSKAQDS
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Determines the fate of epidermal cell differentiation. Represses trichome development by lateral inhibition. Together with GL3 or BHLH2, promotes the formation of hair developing cells (H position) in root epidermis, probably by inhibiting non-hair cell formation. Represses the expression of GL2 and WER in H cells. Positively regulates stomatal formation in the hypocotyl (PubMed:19513241). {ECO:0000269|PubMed:11910008, ECO:0000269|PubMed:12356720, ECO:0000269|PubMed:16291794, ECO:0000269|PubMed:19513241, ECO:0000269|PubMed:9262483}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN35071.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Transcriptional repression correlates with reduced histone acetylation on H3 and H4 mediated by HDA18 in root epidermis N cells (non-hair developing cells). Induced by WER. Negative autoregulation by interfering with the binding of WER to its WER-binding sites (WBS) promoter region, especially in H cells. Down-regulated by GEM. Down-regulated by TMM (PubMed:19513241). {ECO:0000269|PubMed:11910008, ECO:0000269|PubMed:15795220, ECO:0000269|PubMed:16176989, ECO:0000269|PubMed:16207757, ECO:0000269|PubMed:17450124, ECO:0000269|PubMed:19513241}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0919491e-122BT091949.1 Soybean clone JCVI-FLGm-9O9 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025980064.14e-53MYB-like transcription factor isoform X1
RefseqXP_028186972.14e-53transcription factor CPC-like isoform X1
SwissprotO220596e-28CPC_ARATH; Transcription factor CPC
TrEMBLA0A0R0HKR09e-52A0A0R0HKR0_SOYBN; Uncharacterized protein
TrEMBLA0A445HVS99e-52A0A445HVS9_GLYSO; Transcription factor CPC
STRINGGLYMA11G02061.17e-53(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35832757
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30420.14e-25MYB_related family protein
Publications ? help Back to Top
  1. Savage N, et al.
    Positional signaling and expression of ENHANCER OF TRY AND CPC1 are tuned to increase root hair density in response to phosphate deficiency in Arabidopsis thaliana.
    PLoS ONE, 2013. 8(10): p. e75452
    [PMID:24130712]
  2. Nayidu NK, et al.
    Comparison of five major trichome regulatory genes in Brassica villosa with orthologues within the Brassicaceae.
    PLoS ONE, 2014. 9(4): p. e95877
    [PMID:24755905]
  3. Wada T,Hayashi N,Tominaga-Wada R
    Root hair formation at the root-hypocotyl junction in CPC-LIKE MYB double and triple mutants of Arabidopsis.
    Plant Signal Behav, 2015. 10(11): p. e1089372
    [PMID:26339713]
  4. Huang M,Hu Y,Liu X,Li Y,Hou X
    Arabidopsis LEAFY COTYLEDON1 controls cell fate determination during post-embryonic development.
    Front Plant Sci, 2015. 6: p. 955
    [PMID:26579186]
  5. Tominaga-Wada R,Wada T
    The ectopic localization of CAPRICE LIKE MYB3 protein in Arabidopsis root epidermis.
    J. Plant Physiol., 2016. 199: p. 111-115
    [PMID:27302012]
  6. Hegebarth D,Buschhaus C,Wu M,Bird D,Jetter R
    The composition of surface wax on trichomes of Arabidopsis thaliana differs from wax on other epidermal cells.
    Plant J., 2016. 88(5): p. 762-774
    [PMID:27496682]
  7. Tominaga-Wada R,Kurata T,Wada T
    Localization of ENHANCER OF TRY AND CPC1 protein in Arabidopsis root epidermis.
    J. Plant Physiol., 2017. 214: p. 48-52
    [PMID:28437677]
  8. Tominaga-Wada R,Kurata T,Wada T
    Localization of the CAPRICE-ENHANCER OF TRY AND CPC1 chimera protein in Arabidopsis root epidermis.
    Biosci. Biotechnol. Biochem., 2017. 81(9): p. 1762-1767
    [PMID:28644769]
  9. Tominaga-Wada R,Wada T
    Extended C termini of CPC-LIKE MYB proteins confer functional diversity in Arabidopsis epidermal cell differentiation.
    Development, 2017. 144(13): p. 2375-2380
    [PMID:28676568]
  10. Canales J,Contreras-López O,Álvarez JM,Gutiérrez RA
    Nitrate induction of root hair density is mediated by TGA1/TGA4 and CPC transcription factors in Arabidopsis thaliana.
    Plant J., 2017. 92(2): p. 305-316
    [PMID:28771873]
  11. Tominaga-Wada R,Wada T
    Effect of amino acid substitution of CAPRICE on cell-to-cell movement ability in Arabidopsis root epidermis.
    Dev. Biol., 2018. 435(1): p. 1-5
    [PMID:29337129]
  12. Kohanová J, et al.
    Root hair abundance impacts cadmium accumulation in Arabidopsis thaliana shoots.
    Ann. Bot., 2018. 122(5): p. 903-914
    [PMID:29394308]