PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN34752.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Trihelix
Protein Properties Length: 246aa    MW: 29598.4 Da    PI: 6.1992
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN34752.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix78.11.3e-241193186
    trihelix  1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86
                +W+ qe+++ + +r+e+++++ ++k++k+lWe +s++m+e+g++rs++qCk+kw+nl +ryk  +++e++    +++++p++++ +
  KHN34752.1 11 QWSIQETKEFLVIREELDQTFMETKRNKQLWEVISNRMKEKGYHRSAEQCKCKWKNLVTRYKGFETMEQEA---TRQQFPFYNEFN 93
                7********************************************************************96...45679**99865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd122034.12E-211073No hitNo description
PfamPF138375.0E-201195No hitNo description
PROSITE profilePS500907.5491268IPR017877Myb-like domain
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MNVDVTDRFP QWSIQETKEF LVIREELDQT FMETKRNKQL WEVISNRMKE KGYHRSAEQC  60
KCKWKNLVTR YKGFETMEQE ATRQQFPFYN EFNAIFTARM QRMLWAEAEG GSKKNKATTQ  120
LSSDENEEST EAGSGRKKKK AKIGSRGGDN CSGSFNSLKE ILEEFMRQQM QIDTQWMEAF  180
EARENERRLK EMEWRQAMEV LENERIMMEE RWREREEQRR IREEARAEER DALITALLNK  240
LERQGM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150421e-128AP015042.1 Vigna angularis var. angularis DNA, chromosome 9, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003516961.11e-179PREDICTED: trihelix transcription factor GT-3b-like
SwissprotQ9SDW01e-67TGT3A_ARATH; Trihelix transcription factor GT-3a
TrEMBLI1J7E11e-179I1J7E1_SOYBN; Uncharacterized protein
STRINGGLYMA01G29760.11e-179(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17813385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G01380.17e-65Trihelix family protein