PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN34587.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family G2-like
Protein Properties Length: 261aa    MW: 28349.6 Da    PI: 6.9037
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN34587.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.92.4e-333589155
     G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                k+rlrWt++LH+rFv+a++qLGG+++AtPk +l++m+v+gLt++hvkSHLQkYRl
  KHN34587.1 35 KQRLRWTSDLHDRFVDAITQLGGPDRATPKGVLRVMGVPGLTIYHVKSHLQKYRL 89
                79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.8843292IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.5E-323390IPR009057Homeodomain-like
SuperFamilySSF466893.05E-173489IPR009057Homeodomain-like
TIGRFAMsTIGR015574.0E-263590IPR006447Myb domain, plants
PfamPF002491.3E-73788IPR001005SANT/Myb domain
PfamPF143798.9E-25123169IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MVPHKSQGGA EQLANAGVLG GSAVKTAAPS GGSGKQRLRW TSDLHDRFVD AITQLGGPDR  60
ATPKGVLRVM GVPGLTIYHV KSHLQKYRLA KYLPESPADG KDPKDEKRMS GDSISGADSS  120
SGMPINDALR MQMEVQKRLH EQLEVQKQLQ MRIEAQGKYL QKIIEEQQKL GSTLTTSETL  180
PLSHDKQNHP QSEASGSSDA LASTVSPLKK QRIDDGSKEG FTASQVRKND NVGQLDPNLY  240
DDAGFGFDLE TKKDEDNESG Q
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ0073110.0HQ007311.1 Glycine max cultivar Jidou11 MYB transcription factor (PHR1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006604294.10.0PREDICTED: protein PHR1-LIKE 1-like isoform X1
RefseqXP_003554081.10.0PREDICTED: protein PHR1-LIKE 1-like isoform X1
SwissprotQ8GUN51e-52PHL1_ARATH; Protein PHR1-LIKE 1
TrEMBLA0A0B2RS120.0A0A0B2RS12_GLYSO; Myb family transcription factor APL
TrEMBLI1N8J60.0I1N8J6_SOYBN; Uncharacterized protein
STRINGGLYMA19G30220.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130132330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.17e-64G2-like family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]