PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN34443.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family TALE
Protein Properties Length: 199aa    MW: 22850.9 Da    PI: 7.1475
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN34443.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox24.35.2e-081441772154
                 HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 k +yp+++++++L +++gL+ +q+ +WF N+R +
  KHN34443.1 144 KWPYPTEDDKAKLVEETGLQLKQINNWFINQRKR 177
                 469*****************************87 PP

2ELK26.21.8e-0998119122
         ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                 ELK +L++++++++ ++++E++
  KHN34443.1  98 ELKIELKQGFKSRIEDVREEIL 119
                 9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF037911.2E-11141IPR005541KNOX2
SMARTSM012563.3E-11142IPR005541KNOX2
PROSITE profilePS512139.13298118IPR005539ELK domain
PROSITE profilePS5007111.645118181IPR001356Homeobox domain
SMARTSM003893.4E-11120185IPR001356Homeobox domain
SuperFamilySSF466891.54E-16120185IPR009057Homeodomain-like
CDDcd000861.11E-11121182No hitNo description
Gene3DG3DSA:1.10.10.607.4E-26125183IPR009057Homeodomain-like
PfamPF059205.7E-18138177IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 199 aa     Download sequence    Send to blast
MAQYLIVLCT FKEQLQQHVR VHAVEAVMAC RDIESTLQAL TGVSLGEGTG ATMSDDEDDL  60
QMDGSLDQSS AEGHDLMGFG PLLPTESERS LMERVRQELK IELKQGFKSR IEDVREEILR  120
KRRAGKLPGD TTSVLKAWWQ QHAKWPYPTE DDKAKLVEET GLQLKQINNW FINQRKRNWH  180
SNSQSVTSLK SKRKREYAH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A8e-14121177864Homeobox protein PKNOX1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1174194RKRNWHSNSQSVTSLKSKRKR
Functional Description ? help Back to Top
Source Description
UniProtPossible developmental regulator.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN34443.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By wounding; up to 7-fold increase.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0939000.0BT093900.1 Soybean clone JCVI-FLGm-17N4 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003525739.11e-146homeobox protein HD1
RefseqXP_028231658.11e-146homeobox protein HD1-like
SwissprotP466061e-123HD1_BRANA; Homeobox protein HD1
TrEMBLA0A445KJB21e-145A0A445KJB2_GLYSO; Homeobox protein knotted-1-like 7 isoform A
TrEMBLI1K0E51e-145I1K0E5_SOYBN; Uncharacterized protein
STRINGGLYMA05G03650.11e-146(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF63483450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62990.11e-124KNOTTED-like homeobox of Arabidopsis thaliana 7
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]
  2. Boivin R,Hamel F,Beauseigle D,Bellemare G
    Stage-specific transcription of the homebox gene Bnhd1 in young tissues and flowers of Brassica napus.
    Biochim. Biophys. Acta, 1994. 1219(1): p. 201-4
    [PMID:7916213]