PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN34103.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB_related
Protein Properties Length: 363aa    MW: 41053.1 Da    PI: 8.6381
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN34103.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding25.23.7e-082869346
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                      ++  Ed ++  + +  G + W+ Ia+ ++ gRt++++  +w++
       KHN34103.1 28 EFSNKEDRIICSLYANIGIR-WSIIAAQLP-GRTDNDINKYWNT 69
                     68999***************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-7633IPR009057Homeodomain-like
SuperFamilySSF466897.89E-16675IPR009057Homeodomain-like
PROSITE profilePS5129418.452175IPR017930Myb domain
SMARTSM007171.8E-72573IPR001005SANT/Myb domain
PfamPF002491.2E-62769IPR001005SANT/Myb domain
CDDcd001671.43E-52871No hitNo description
Gene3DG3DSA:1.10.10.605.1E-163472IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MNIGLRRCGK SYRLRWLNYL RPNIRHMEFS NKEDRIICSL YANIGIRWSI IAAQLPGRTD  60
NDINKYWNTK LKRKLMGLLP SSHQRIAPYQ QFSSQNPSSF PSHSSLSSSQ YRDYYYNNSN  120
HYYIPAPTSY FISLEPISAP SSNHRNTIKT SNSLPFYQHQ ERPCSSDGSC GQVSLGREIK  180
QQDIGFQNFM FGDHQNMNKF MNINHDGGQE YVNQWTQNPN SPNQLLYHFE QPIDRHPLIP  240
GILDIIGIRY TGGGCERFGG STMLLSKVPL IEEGSNDNLF HHHEGSDATG GNLSSIPNAG  300
SALFGVAIEK GLRPNFAIRP NPGEDEAKLS LPHPSLNVIN LDYEAIVGQV IVPYPFIPPP  360
SLR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-1577540108B-MYB
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN34103.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1392272e-56BT139227.1 Lotus japonicus clone JCVI-FLLj-1K11 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003539432.19e-99transcription factor RAX2
RefseqXP_028193549.19e-99transcription factor RAX2-like
TrEMBLA0A0B2RPD50.0A0A0B2RPD5_GLYSO; Transcription factor RAX3
STRINGGLYMA12G30140.13e-98(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13034340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.12e-36myb domain protein 36
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]