PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN33447.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family LBD
Protein Properties Length: 172aa    MW: 19163.8 Da    PI: 5.7466
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN33447.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.61.9e-4231021100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +CaaCk+lrr+Ca++Cvlapyfp ++p+kf  +h++FGasn++k+l++lpe++r da++s+vyeA ar+rdPvyG++g i +lq+q+++l+a+la++++
  KHN33447.1   3 PCAACKILRRRCAEKCVLAPYFPPTEPAKFTTAHRVFGASNIIKFLQELPESQRADAVASMVYEAGARIRDPVYGCAGAICQLQKQVNELQAQLAKAQA 101
                 7***********************************************************************************************997 PP

      DUF260 100 e 100
                 e
  KHN33447.1 102 E 102
                 6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.0112103IPR004883Lateral organ boundaries, LOB
PfamPF031958.8E-433100IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0004088Molecular Functioncarbamoyl-phosphate synthase (glutamine-hydrolyzing) activity
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
MSPCAACKIL RRRCAEKCVL APYFPPTEPA KFTTAHRVFG ASNIIKFLQE LPESQRADAV  60
ASMVYEAGAR IRDPVYGCAG AICQLQKQVN ELQAQLAKAQ AEVVNMQLQQ ANLVALICME  120
MAQTQTPQEY SPQQSVDNFI SSTSHSSGYQ NNLNFFEENT NNLNSLWEPL WT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-42210510113LOB family transfactor Ramosa2.1
5ly0_B3e-42210510113LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN33447.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0971751e-121BT097175.1 Soybean clone JCVI-FLGm-21N19 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006597316.11e-124LOB domain-containing protein 11
RefseqXP_028203689.11e-124LOB domain-containing protein 11-like
SwissprotQ9SK089e-76LBD11_ARATH; LOB domain-containing protein 11
TrEMBLA0A445GNZ41e-123A0A445GNZ4_GLYSO; LOB domain-containing protein 11
TrEMBLI1MDM71e-123I1MDM7_SOYBN; Uncharacterized protein
STRINGGLYMA15G05030.11e-124(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.16e-69LOB domain-containing protein 11
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]