PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN33396.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family WOX
Protein Properties Length: 219aa    MW: 24917.9 Da    PI: 8.0868
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN33396.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox629.3e-202483357
                --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
    Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                +R+++tkeq++ Le+++++  r+ps+e++++++++l     ++ ++V++WFqN++a++++
  KHN33396.1 24 SRWSPTKEQIDMLENFYKQgIRTPSTEQIQQITSRLraygYIEGKNVFYWFQNHKARQRQ 83
                6*****************99*******************99*****************97 PP

2Wus_type_Homeobox110.41e-352384364
  Wus_type_Homeobox  3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
                        +RW+Pt+eQi +Le+ yk+G+rtP++e+iq+it++L++yG ie+kNVfyWFQN+kaR+rqk
         KHN33396.1 23 VSRWSPTKEQIDMLENFYKQGIRTPSTEQIQQITSRLRAYGYIEGKNVFYWFQNHKARQRQK 84
                       68***********************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007111.1591984IPR001356Homeobox domain
SMARTSM003896.9E-62188IPR001356Homeobox domain
SuperFamilySSF466892.74E-122489IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.1E-92483IPR009057Homeodomain-like
PfamPF000461.6E-172483IPR001356Homeobox domain
CDDcd000863.16E-62579No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
MESHSTAEDE SGRKGSSGAH SSVSRWSPTK EQIDMLENFY KQGIRTPSTE QIQQITSRLR  60
AYGYIEGKNV FYWFQNHKAR QRQKLKQKQQ SIAYCNCFLH ASHPICQNVV CAPYCLQKSG  120
FSFYPHQPKV LASVGISSRI ETGSFGMLRI CDGMQSEHPD YNYSTSNREA LTLFPLHPTG  180
ILEEKTTHHS VDVTDKSFVS IAVDENGHLG NQHCFNFQY
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN33396.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0965100.0BT096510.1 Soybean clone JCVI-FLGm-15H19 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028203238.11e-167uncharacterized protein LOC114387285
TrEMBLA0A445GP011e-165A0A445GP01_GLYSO; WUSCHEL-related homeobox 2
STRINGGLYMA15G04460.11e-163(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF82563044
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59340.11e-33WUSCHEL related homeobox 2
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]