PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN33393.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 304aa    MW: 33188.1 Da    PI: 9.9777
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN33393.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.81.2e-3869127462
      zf-Dof   4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                   lkcprC+stntkfCy+nnyslsqPr+fCk+CrryWt+GGalrnvPvGgg+r+nkk++
  KHN33393.1  69 GVLKCPRCESTNTKFCYFNNYSLSQPRHFCKTCRRYWTRGGALRNVPVGGGCRRNKKHK 127
                 5789****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074788.0E-2954120IPR003851Zinc finger, Dof-type
PfamPF027016.6E-3370125IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.53471125IPR003851Zinc finger, Dof-type
PROSITE patternPS01361073109IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MVFSSIPVYS DPPNWQQQQQ NQHQANGINS PQLLSPLPQP PQAPHVGVES EQIRSGLMAD  60
RAKIPAPEGV LKCPRCESTN TKFCYFNNYS LSQPRHFCKT CRRYWTRGGA LRNVPVGGGC  120
RRNKKHKRSR SKSPVSTDKP SLPNSTSAIP ELIGRFPQPF IASLQSMNRY GVGNTGVNLR  180
EIQAQNGSQM GFQIGGHGNG TSSVATAGGG VEQWRFQQFP FLNGFESTLA VSNSYPFQSE  240
SVEGLVGDIA ASSRATQLPA RVKMEYNGGL NLSRSPLSVS ENSNHYYSWT DLSGLVSSSA  300
SHLL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150400.0AP015040.1 Vigna angularis var. angularis DNA, chromosome 7, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003547369.10.0PREDICTED: dof zinc finger protein DOF3.6-like
TrEMBLA0A0B2RMR40.0A0A0B2RMR4_GLYSO; Dof zinc finger protein DOF3.6
STRINGGLYMA15G04430.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65634143
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.18e-42OBF-binding protein 3
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]