PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN33372.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GRAS
Protein Properties Length: 1291aa    MW: 145670 Da    PI: 6.0437
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN33372.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS369.74e-1132386043374
        GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqa 101
                 +lL++cA+av++ d+++a++lL+++++++sp gd +qRla+yf+++L++rla    ++ + +p + ++    ++ l+a+klf+  sP+ ++++ ++ ++
  KHN33372.1 238 TLLTQCAQAVANYDQRNANELLKQIRQHSSPFGDGLQRLAHYFANGLETRLAA---GTPSYMPLEVAT---AADMLKAYKLFVTSSPLQRLTNYLTTKT 330
                 69**************************************************9...333344444444...789************************* PP

        GRAS 102 IleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkp 198
                 I   v++e+ vHi Df+i +G+QWp+L+++L++R +gpp+lRiTg++ p++g   +e++eetg+rLa+f+++++vpfe+n  +a+++e+++l +L++++
  KHN33372.1 331 IISLVKNESSVHIMDFGICYGFQWPCLIKKLSDRHGGPPRLRITGIDLPQPGfrPAERVEETGRRLANFCKKFNVPFEYNC-LAQKWETIRLADLKIDR 428
                 ***************************************************9*****************************.6**************** PP

        GRAS 199 gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnv 297
                 +E+++V++ ++l++l+de+v+++ +rd+vLkl+++++P+v+++   +  ++++ Fl+rf eal+++s+lfd +ea++pre+ +r+++E+ l+gr++ nv
  KHN33372.1 429 NEVTVVSCFYRLKNLPDETVDVKCPRDAVLKLIRKINPNVFIHGVVNGAYSAPFFLTRFREALYHFSSLFDVYEANVPREDPQRVMLEKGLFGRDAINV 527
                 *************************************************************************************************** PP

        GRAS 298 vacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                 vacegaer+er et+++W+ r  +aGFk++pl+ + +++ak ++++ + + + v e++++++lgWk+r L ++SaW+
  KHN33372.1 528 VACEGAERVERPETYKQWQVRNLRAGFKQLPLDPQLVNDAKDIVKREYHKDFVVAENDKWVLLGWKGRILNAISAWT 604
                 ************************************************888*************************6 PP

2GRAS370.81.8e-11392312893374
        GRAS    3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaN 99  
                  +lL++cA+av+s d+++a+ lL+++++++s  gd +qRla+yf+++L++rla    ++ + +p + t+   s++ l+a+kl++  sP+ ++++ +a 
  KHN33372.1  923 TLLTQCAQAVASFDQRNANDLLSQIRQHSSAFGDGLQRLAHYFANGLETRLAA---GTPSYMPLEGTT---SADMLKAYKLYVTSSPLQRLTNYLAT 1013
                  69**************************************************9...555556666666...89************************ PP

        GRAS  100 qaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeL 194 
                  q+I+  ve+e  vHiiDf+i +G+QWp+L+++L++R +gpp+lRiTg++ p++g   +e++eetg+rLa+++++++vpfe+n  +a+++e+++l +L
  KHN33372.1 1014 QTIVSLVENEGSVHIIDFGICYGFQWPCLIKKLSERHGGPPRLRITGIELPQPGfrPAERVEETGRRLANYCKKFNVPFEYNC-LAQKWETIKLADL 1109
                  *****************************************************9*****************************.6************ PP

        GRAS  195 rvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellg 291 
                  +++++E+++V++ ++l++l+de+v+++s+rd+vLkl++ ++P+++++   +  ++++ Fl+rf eal+++s+lfd++ea++pre+ er+++E+ l+g
  KHN33372.1 1110 KIDRNEVTVVSCFYRLKNLPDETVEVKSPRDAVLKLIRMINPNMFIHGVVNGTYSAPFFLTRFREALYHFSSLFDMFEANVPREDPERVMLEKGLFG 1206
                  ************************************************************************************************* PP

        GRAS  292 reivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374 
                  r++ nv+acegaer+er et+++W+ r ++aGFk+v+++ + ++  k +++k + + + v e+ ++++lgWk+r L ++SaW+
  KHN33372.1 1207 RDAINVIACEGAERVERPETYKQWQVRNQRAGFKQVRFDPQLVNHEKEMVKKEYHKDFVVAEDGKWVLLGWKGRILNAISAWT 1289
                  ****************************************************99888*************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098564.111210584IPR005202Transcription factor GRAS
PfamPF035141.4E-110238604IPR005202Transcription factor GRAS
PROSITE profilePS5098563.3888951269IPR005202Transcription factor GRAS
PfamPF035146.3E-1119231289IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 1291 aa     Download sequence    Send to blast
MEFTKYSNPI LRYISDILMD EEDDLECKPC MLQECLRLQA AEKSFHDALL HQNPSPFRDE  60
NTCITDSDEI FGRIPSFVSS GSCTTDNSCE SDLLNGVSEF NSSFLQLQTP LVDSPEDGYF  120
HDGTWNLFQS HTKPLMVEEG TPASALREKR SHGMDGHASH EKEGRRGSKV SAIFSDDSEP  180
REILDEVLLY QTGGSQPLYS APTEPSQRVD LGRSNGKATR LRSKKVSTNM ETTVDLWTLL  240
TQCAQAVANY DQRNANELLK QIRQHSSPFG DGLQRLAHYF ANGLETRLAA GTPSYMPLEV  300
ATAADMLKAY KLFVTSSPLQ RLTNYLTTKT IISLVKNESS VHIMDFGICY GFQWPCLIKK  360
LSDRHGGPPR LRITGIDLPQ PGFRPAERVE ETGRRLANFC KKFNVPFEYN CLAQKWETIR  420
LADLKIDRNE VTVVSCFYRL KNLPDETVDV KCPRDAVLKL IRKINPNVFI HGVVNGAYSA  480
PFFLTRFREA LYHFSSLFDV YEANVPREDP QRVMLEKGLF GRDAINVVAC EGAERVERPE  540
TYKQWQVRNL RAGFKQLPLD PQLVNDAKDI VKREYHKDFV VAENDKWVLL GWKGRILNAI  600
SAWTYMSCNF LVEFNMNSLV QNFSGPITEF SNQNQVEKGF DFEFDDSSSS LSSGASSGGE  660
STEVTKYSNQ ILRYISDILM DEEDDLERKP CMLQECLRLQ AAEKSFHDAL LHQPSSRFRD  720
ESVSITDSDE NYGRNASFES NGSCTTDNSC ESVLVNGVGE FDSSFLQLQT PLVDSPHDPS  780
GESPGVGFFH DPFVKSQAAG YFHDGTWNLF QSQSQTKKPL MVEEGFSASA PREKRSHGMD  840
DYAFHEQEGR RGSKVSAVFS DESESPEILD EVLLCQSGRS QSLLCAAAEP SQSVNLGGSN  900
GKGTRSRSKK VSTKAGTAVD LWTLLTQCAQ AVASFDQRNA NDLLSQIRQH SSAFGDGLQR  960
LAHYFANGLE TRLAAGTPSY MPLEGTTSAD MLKAYKLYVT SSPLQRLTNY LATQTIVSLV  1020
ENEGSVHIID FGICYGFQWP CLIKKLSERH GGPPRLRITG IELPQPGFRP AERVEETGRR  1080
LANYCKKFNV PFEYNCLAQK WETIKLADLK IDRNEVTVVS CFYRLKNLPD ETVEVKSPRD  1140
AVLKLIRMIN PNMFIHGVVN GTYSAPFFLT RFREALYHFS SLFDMFEANV PREDPERVML  1200
EKGLFGRDAI NVIACEGAER VERPETYKQW QVRNQRAGFK QVRFDPQLVN HEKEMVKKEY  1260
HKDFVVAEDG KWVLLGWKGR ILNAISAWTP A
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-4224012888374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016169454.10.0PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC107612146
TrEMBLA0A0B2RNF80.0A0A0B2RNF8_GLYSO; Scarecrow-like protein 33
STRINGGLYMA15G04160.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13134339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29060.11e-161GRAS family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]