PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN33326.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family EIL
Protein Properties Length: 468aa    MW: 52220.9 Da    PI: 4.8444
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN33326.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3191.29.1e-59381611127
                 XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
        EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraWWkekv 99 
                 eel++rmwkd+++lkrlke++k   e+++a ++++k ++s++qarrkkmsraQDgiLkYMlk mevc+a+GfvYgiipekgkpv+g+sd++raWWkekv
  KHN33326.1  38 EELERRMWKDRIKLKRLKEKQKL--EAQQA-AEKQKPRQSSDQARRKKMSRAQDGILKYMLKLMEVCKARGFVYGIIPEKGKPVSGSSDNIRAWWKEKV 133
                 8****************999986..45665.99****************************************************************** PP

                 XXXXXXXXXXXXXXXXXXXXXXXXXX.. CS
        EIN3 100 efdrngpaaiskyqaknlilsgesslqt 127
                 +fd+ngpaai+ky+a++l++s++++++ 
  KHN33326.1 134 RFDKNGPAAIAKYEADCLAMSEADNSRN 161
                 *********************9988843 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048735.0E-5738161No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 468 aa     Download sequence    Send to blast
MGEIEEIGAD VCSDIEVDDI RCPNIAEKDV SDEEIEAEEL ERRMWKDRIK LKRLKEKQKL  60
EAQQAAEKQK PRQSSDQARR KKMSRAQDGI LKYMLKLMEV CKARGFVYGI IPEKGKPVSG  120
SSDNIRAWWK EKVRFDKNGP AAIAKYEADC LAMSEADNSR NEEALIRQPS SDNGTSGITG  180
VPPGVPVENK QAATSSASNY DVDGTDDGIG SVSSKENRRN HFMVTEPSDN LRRGRKPVQD  240
TDQSEKQPRP KKPRRANDKP PAQADNEILH VEPRSKGINI NQTEAQVVGV QIHGNEQSNE  300
TDSAARPLER GLEVPAQLPV PEVDQYSYLH TNNLVSSESM YMSGKPMHYP ELQNPDMHHE  360
TTYNLYNPAA GYEPGQDGQQ LHSANNEAVR LENDAVSLQG VHMKGDGING GDLQYFGKDA  420
FQNELDRPMD HSFFGSPLSM SLDFGALGSP FHLDDFVCED EMIQYFGA
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN33326.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150400.0AP015040.1 Vigna angularis var. angularis DNA, chromosome 7, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006597241.10.0ETHYLENE INSENSITIVE 3-like 3 protein
RefseqXP_028203921.10.0ETHYLENE INSENSITIVE 3-like 3 protein
TrEMBLA0A151SUJ80.0A0A151SUJ8_CAJCA; ETHYLENE INSENSITIVE 3-like 3 protein
STRINGGLYMA15G03650.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1820556
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73730.12e-59ETHYLENE-INSENSITIVE3-like 3
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]