PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN33284.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Nin-like
Protein Properties Length: 973aa    MW: 107384 Da    PI: 6.1384
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN33284.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK93.21.9e-29602652252
      RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                 ek++sl++l++yFs+++kdAAk++gvc+T+LKriCRq+GI+RWP+Rki+++
  KHN33284.1 602 EKNVSLSVLQQYFSGSLKDAAKKIGVCPTTLKRICRQHGIPRWPSRKINKV 652
                 89***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.291586672IPR003035RWP-RK domain
PfamPF020423.7E-26604652IPR003035RWP-RK domain
SuperFamilySSF542771.67E-21870958No hitNo description
PROSITE profilePS5174520.772873955IPR000270PB1 domain
SMARTSM006663.4E-21873955IPR000270PB1 domain
CDDcd064076.35E-31874954No hitNo description
Gene3DG3DSA:3.10.20.2407.9E-22874955No hitNo description
PfamPF005642.6E-16876954IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 973 aa     Download sequence    Send to blast
MEYPFSPKES VIGDWQSSGA QLEGSASLDG RMSNSIPEDM PNSFSELMNF DTYAGLCNSP  60
SITDQILAND LPSFASLSYP LPDGFNLVQQ YSGQYCMSGV GRNNNDMESS PIYGEKVVCQ  120
QMDTLLGCLN DTNEANNLNS KLKMNSSSQH LNNFDTGNYM MSRSPGLSLD ERMLRALSFF  180
KESAGGGILA QVWVPIKHGD QFILSTSDQP YLLDQMLAGY REVSRTFTFS TEGKSGCFLG  240
LPGRVFTSKV PEWTSNVGYY SMSEYLRFEH AINHKVRGSI AIPIFDLHSE FPCCAVLELV  300
TTKEKPDFDR ELEIVRHALQ LVNLRTVKTL RCLPQSLSNN KKATLTEIVD VLRSVCHAHR  360
LPLALTWIPC GYTECSRGEA SRIRIKGGHS TSSEKSVLCL EESACYITDR AMAGFIRACM  420
EHHLEEGKGI AGKALQSNHP FFYPDVKTYD ISEYPLVHHA RKYNLNAAVA IRLRSTYTND  480
DDYILEFFLP VNMRGSSEQQ LLLDNLSGTM QRICSSLRTV SETELSGIES SPVGLGKKNA  540
PSFFPLSSRN SDIPLINGDC DSVQKMSLKA TTNLKDNEIE PSPNQERNGS KRQVQKNRST  600
SEKNVSLSVL QQYFSGSLKD AAKKIGVCPT TLKRICRQHG IPRWPSRKIN KVNRSLKKIQ  660
TVLDSVQGME GGLKFDPSMG AFVAGGSIIQ EIDAPKSTIK DPVPVTQDAF SVPPAPCSEG  720
ENFSIKLEGK LKKTNVSSVD YSEDSKSMAI NDGSCQMASL CTKVQDCPEQ ACLGSVLAKE  780
HDKRILNKGG LSVEKFKHNI VGQSSKSLIA DEMDIGVDGD DGVVERNHPT SSSLTDSSNG  840
SGSMMHSSSS GSRSFENQDQ SKVKSTIIDC GSKLIVKATY REDTIRFKFD PSEGCFRLYE  900
EVAARFKLQN GLFQLKYLDD EEEWVMLVND ADLQECIEIL DDIGTRSVRF LVRDMPSVLS  960
SSGSSNSYLG GSS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2353120.0AC235312.1 Glycine max strain Williams 82 clone GM_WBb0071J06, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003546980.10.0PREDICTED: protein NLP8-like
RefseqXP_006597207.10.0PREDICTED: protein NLP8-like
RefseqXP_006597208.10.0PREDICTED: protein NLP8-like
RefseqXP_014623508.10.0PREDICTED: protein NLP8-like
RefseqXP_014623509.10.0PREDICTED: protein NLP8-like
RefseqXP_014623510.10.0PREDICTED: protein NLP8-like
SwissprotO228640.0NLP8_ARATH; Protein NLP8
TrEMBLA0A0B2RLX00.0A0A0B2RLX0_GLYSO; Protein NLP8
TrEMBLK7M9790.0K7M979_SOYBN; Uncharacterized protein
STRINGGLYMA15G03225.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF34643465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G59580.20.0Nin-like family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]