PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN33184.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family LBD
Protein Properties Length: 55aa    MW: 6410.56 Da    PI: 9.9923
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN33184.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26049.21.6e-151854440
      DUF260  4 aCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGas 40
                aCk+lrrkC  dC+++pyfp ++p+kf nvhk+F+as
  KHN33184.1 18 ACKFLRRKCMLDCIFSPYFPPKEPQKFTNVHKIFRAS 54
                9*********************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089113.5461455IPR004883Lateral organ boundaries, LOB
PfamPF031951.7E-131754IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0004088Molecular Functioncarbamoyl-phosphate synthase (glutamine-hydrolyzing) activity
Sequence ? help Back to Top
Protein Sequence    Length: 55 aa     Download sequence    Send to blast
IAVKIMASSS YSNSPYDACK FLRRKCMLDC IFSPYFPPKE PQKFTNVHKI FRASF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-17854450LOB family transfactor Ramosa2.1
5ly0_B2e-17854450LOB family transfactor Ramosa2.1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtNot known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN33184.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0908399e-64BT090839.1 Soybean clone JCVI-FLGm-5B3 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007140818.11e-24hypothetical protein PHAVU_008G144700g
RefseqXP_017417992.11e-24PREDICTED: LOB domain-containing protein 25-like isoform X1
RefseqXP_027929654.11e-24LOB domain-containing protein 25-like isoform X2
SwissprotQ8L8Q32e-19LBD25_ARATH; LOB domain-containing protein 25
SwissprotQ9FML44e-19LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES
TrEMBLA0A0B2RLJ23e-32A0A0B2RLJ2_GLYSO; LOB domain-containing protein 25 (Fragment)
STRINGGLYMA16G09720.15e-27(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3639922
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27650.17e-22LOB domain-containing protein 25
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]
  2. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]
  3. Xu C, et al.
    Control of auxin-induced callus formation by bZIP59-LBD complex in Arabidopsis regeneration.
    Nat Plants, 2018. 4(2): p. 108-115
    [PMID:29358751]
  4. Liu J, et al.
    The WOX11-LBD16 Pathway Promotes Pluripotency Acquisition in Callus Cells During De Novo Shoot Regeneration in Tissue Culture.
    Plant Cell Physiol., 2018. 59(4): p. 734-743
    [PMID:29361138]