PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN33018.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family G2-like
Protein Properties Length: 267aa    MW: 30005.6 Da    PI: 8.6173
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN33018.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.91.1e-3360113255
     G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 prlrWtp+LH++Fv+av++LGG+++AtPk +l+lm+vkgLt++hvkSHLQ+YR+
  KHN33018.1  60 PRLRWTPDLHRCFVHAVQRLGGENRATPKLVLQLMNVKGLTISHVKSHLQMYRS 113
                 8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-3256115IPR009057Homeodomain-like
PROSITE profilePS5129411.23556116IPR017930Myb domain
SuperFamilySSF466893.4E-1658114IPR009057Homeodomain-like
TIGRFAMsTIGR015579.1E-2560113IPR006447Myb domain, plants
PfamPF002491.4E-961112IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MSSSSSSLIT TVVVHNNNNN NPSQPSELRA TTRCCFGSHH LPDISLKTPM ARPYVRSKMP  60
RLRWTPDLHR CFVHAVQRLG GENRATPKLV LQLMNVKGLT ISHVKSHLQM YRSMRHEQMS  120
QGAKKNDMAP DFLASTLSTL GQRQQNPHKR SCTEELVPTQ AQWNHDEQEC HNGNQGGESI  180
IIYNGNEQKV HSYIIFEGLL RGQSVQENKT TTPEKVSLGD AGDERDHQRF QDTLSLSMSS  240
RPSSHSFLNR SHTGPDANDV SLELTLC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150385e-57AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006597590.10.0PREDICTED: putative Myb family transcription factor At1g14600
TrEMBLA0A0R0FZ580.0A0A0R0FZ58_SOYBN; Uncharacterized protein
STRINGGLYMA15G11576.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF93812840
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02060.13e-33G2-like family protein