PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN32749.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family G2-like
Protein Properties Length: 415aa    MW: 46739.5 Da    PI: 6.8837
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN32749.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.62.9e-334599155
     G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                kprl+Wtp+LHerF+eav+qLGG++kAtPkt+l+lm+++gLtl+h+kSHLQkYR`s\vl VE`s\vl VDLHERFIEAVNQLGGADKATPKTVLKLMGIPGLTLYHLKSHLQKYRI 99
                79****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.20142102IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.7E-3143100IPR009057Homeodomain-like
SuperFamilySSF466899.5E-1744100IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-2345100IPR006447Myb domain, plants
PfamPF002493.8E-104798IPR001005SANT/Myb domain
PfamPF143791.3E-24146192IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 415 aa     Download sequence    Send to blast
MYYQQQQQAK NMHALRMHSP TERHMMLQGG NGAGDPGLVL STDAKPRLKW TPDLHERFIE  60
AVNQLGGADK ATPKTVLKLM GIPGLTLYHL KSHLQKYRIS KNMHGQTNTS NNKIASTMEA  120
ATGISEASGV QMKHLSIGLQ TNKNSEINDA LQMQIEVQRR LHEQLEVQRH LQLRIEAQGK  180
YLQAVLEKAQ ETLGRQNLGA EGVEAAKVQL SELASRVSPQ SLDSKFSELK ELQVLWPQQT  240
QEGQATDCSM GSFLNYSEES QRDRETHSMN LNLRACNGPP FSVSKGCAEE SMHLKPDYRL  300
CDEVKENMMF LSSSSNSKVV KGDFLSERPS SLLSMNVGVQ EEENFGRTTV PKEEGWKRRE  360
STETGRVPVK LNYEKISQDY RLANFDVKLD LNSHDDNDAS SHCQQFDLNG FSWNC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150440.0AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006599432.10.0PREDICTED: uncharacterized protein LOC100789797 isoform X4
TrEMBLA0A0B2RKC10.0A0A0B2RKC1_GLYSO; Myb family transcription factor APL
TrEMBLK7MHH90.0K7MHH9_SOYBN; Uncharacterized protein
STRINGGLYMA16G26820.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38523163
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04030.31e-130G2-like family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]