PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN32229.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family WOX
Protein Properties Length: 411aa    MW: 44735.3 Da    PI: 8.6932
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN32229.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.78.4e-1856116257
                 T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
    Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                 ++R+++++eq+++Le+ F++   +p ++e++++ ++l    ++ +++V++WFqNr+ + k+
  KHN32229.1  56 KPRWNPKPEQIRILEAIFNSgMVNPPRDEIRKIRAQLqeygQVGDANVFYWFQNRKSRSKH 116
                 89*****************99*************************************995 PP

2Wus_type_Homeobox1123.1e-3655117264
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 
                        +++RW+P+peQi+iLe++++sG+++P+++ei++i+a+L+eyG+++d+NVfyWFQNrk+R+++k
         KHN32229.1  55 PKPRWNPKPEQIRILEAIFNSGMVNPPRDEIRKIRAQLQEYGQVGDANVFYWFQNRKSRSKHK 117
                        689**********************************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.8E-739115IPR009057Homeodomain-like
PROSITE profilePS5007110.51152117IPR001356Homeobox domain
SuperFamilySSF466894.71E-1252120IPR009057Homeodomain-like
SMARTSM003896.8E-954121IPR001356Homeobox domain
CDDcd000868.30E-955117No hitNo description
PfamPF000462.2E-1556116IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009735Biological Processresponse to cytokinin
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0010075Biological Processregulation of meristem growth
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 411 aa     Download sequence    Send to blast
MASSNRHWPS MFKSKPCSPH HQWQHDINAS LISTSCHRSP YSSGGGGCEE RSPEPKPRWN  60
PKPEQIRILE AIFNSGMVNP PRDEIRKIRA QLQEYGQVGD ANVFYWFQNR KSRSKHKLRH  120
LQNSSSKNMN HHHHMNVDQQ NHTIPTNSSL PQTTTTAPSS SSSSSSEKSS PKELIIPTTK  180
VFSIGFSDAV PNSPTASVNQ TRINDIMLPP PPPVEAFFFP VQQQHDVHHG VTSSSQGFCF  240
SELSNVVHAQ QNNVGPCTSL LLSEIVGHGA ASAGASKKDK SQMKIMHQPS LLNFCVTTPT  300
TATTSTPTTT TTVVVPPITT TSTTVSSPLM PQLQGIGDPG GAARSTVFIN DVAFEVAVGP  360
FNVREAFGDD VVLIHASSGQ PVLTNQWGLT LHSLQHGACY YLVRTLALAL V
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN32229.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0957160.0BT095716.1 Soybean clone JCVI-FLGm-25E14 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001242805.20.0homeobox domain-containing protein
RefseqXP_028184108.10.0WUSCHEL-related homeobox 9-like
TrEMBLA0A0B2RIU30.0A0A0B2RIU3_GLYSO; WUSCHEL-related homeobox 9
STRINGGLYMA10G08030.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38243361
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33880.15e-65homeobox-3
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]