PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN32132.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GRAS
Protein Properties Length: 748aa    MW: 83779.9 Da    PI: 5.4705
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN32132.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS353.53.2e-1083306861359
        GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaN 99 
                 l++lL+ cA+avss+d+  a++lL++++++asp gd +qRla++f++AL+arla++++++y al+ ++ts    ++ ++a++++  ++P+ k+s + aN
  KHN32132.1 330 LRTLLILCAQAVSSDDHVSANELLKQIKQHASPLGDGTQRLAHCFANALEARLAGTGTQIYTALSHKRTS---AADMVKAYQMYISACPFKKLSMIFAN 425
                 5789************************************************************999999...99************************ PP

        GRAS 100 qaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrv 196
                 ++Il+ +++ e++HiiDf+i +G+QWpa++  L+++p+gpp+lRiTg++ p++g   +e+++etg rLa+++++++vpfefn+ +a+++e++++e+L++
  KHN32132.1 426 HTILQLAKEVETLHIIDFGIRYGFQWPAFIYRLSKQPGGPPKLRITGIELPQPGfrPAERVQETGLRLARYCDRFNVPFEFNA-IAQKWETIKIEDLKI 523
                 *****************************************************9*****************************.7************** PP

        GRAS 197 kpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreiv 295
                 k++E l+ n +++ ++llde+v ++s+rd+vLkl+++ +P ++ ++  + ++n++ F++rf eal +ys+lfd l+++++re+  r + Ere++gr+++
  KHN32132.1 524 KENELLVANAMFRFQNLLDETVVVNSPRDAVLKLIRKANPAIFLHATVNGSYNAPFFVTRFREALFHYSTLFDVLDTNVAREDPMRLMFEREFFGRQVM 622
                 *************************************************************************************************** PP

        GRAS 296 nvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslv 359
                 n+vaceg+er+er et+++W+ r ++aGFk++pl+++  ++ ++ l+ v+   +++ e+ + ++
  KHN32132.1 623 NIVACEGSERVERPETYKQWQVRNMRAGFKQLPLDKHLINKLRCKLKGVYHSDFMLLEDGNYML 686
                 **************************************************77799999988776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098567.18304681IPR005202Transcription factor GRAS
PfamPF035141.1E-105330686IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 748 aa     Download sequence    Send to blast
MDNPFLIPPD PNAAQNPFSL SNDEDSPVDE IDFSATVLRY INQMLMEEDL EAKPCMFHDS  60
LALQAAEKSF YEVIGETYPS SSSSSSIQNY HNVDSPDESS FSGTTTSTGN SFGSQWNNVD  120
LADYKPSILQ TTFPTDFVFQ ASSIQSSMNT TSKFAVTNSE FLASSAAGFL GPGSTNLFSK  180
SESVLQFERG VEEANKFLPK GNPLVIDLEN PSFRMVPLQQ EEIKAERDID EISAESRGRK  240
NHEREDEETD LQDGRSNKQS AVYIDDSEIS ELLDKVLLGT GCRNEPAPSC IGYTDLPSGP  300
SLGKLEETNK SGGGKSRVKK QGNKKGVVDL RTLLILCAQA VSSDDHVSAN ELLKQIKQHA  360
SPLGDGTQRL AHCFANALEA RLAGTGTQIY TALSHKRTSA ADMVKAYQMY ISACPFKKLS  420
MIFANHTILQ LAKEVETLHI IDFGIRYGFQ WPAFIYRLSK QPGGPPKLRI TGIELPQPGF  480
RPAERVQETG LRLARYCDRF NVPFEFNAIA QKWETIKIED LKIKENELLV ANAMFRFQNL  540
LDETVVVNSP RDAVLKLIRK ANPAIFLHAT VNGSYNAPFF VTRFREALFH YSTLFDVLDT  600
NVAREDPMRL MFEREFFGRQ VMNIVACEGS ERVERPETYK QWQVRNMRAG FKQLPLDKHL  660
INKLRCKLKG VYHSDFMLLE DGNYMLQGPH FVCFLLLGAG IMRCYCDSVQ NSYYAKACCN  720
GEAYFAGYYV SGSDILGLAT YLLYLQLL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-463346598331GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150390.0AP015039.1 Vigna angularis var. angularis DNA, chromosome 6, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006592195.10.0PREDICTED: scarecrow-like protein 14
SwissprotQ9XE580.0SCL14_ARATH; Scarecrow-like protein 14
TrEMBLA0A0B2RJW90.0A0A0B2RJW9_GLYSO; Scarecrow-like protein 14
STRINGGLYMA12G06670.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13134339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.10.0SCARECROW-like 14
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]