PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN32118.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family WOX
Protein Properties Length: 327aa    MW: 36678 Da    PI: 6.8357
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN32118.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.95.5e-21104163357
                 --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
    Homeobox   3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                 +R+++tkeq+  Le+l+++  ++psaee+++++++l    +++ ++V++WFqN++a++++
  KHN32118.1 104 SRWNPTKEQISMLENLYKQgIKTPSAEEIQQITARLraygHIEGKNVFYWFQNHKARQRQ 163
                 8*****************99**************************************96 PP

2Wus_type_Homeobox115.33e-37102165265
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        +++RW+Pt+eQi +Le+lyk+G++tP++eeiq+ita+L++yG+ie+kNVfyWFQN+kaR+rqkq
         KHN32118.1 102 SSSRWNPTKEQISMLENLYKQGIKTPSAEEIQQITARLRAYGHIEGKNVFYWFQNHKARQRQKQ 165
                        579***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007111.17599164IPR001356Homeobox domain
SMARTSM003892.8E-7101168IPR001356Homeobox domain
SuperFamilySSF466893.76E-13101171IPR009057Homeodomain-like
PfamPF000461.0E-18104163IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.608.3E-9104163IPR009057Homeodomain-like
CDDcd000863.92E-8105165No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009942Biological Processlongitudinal axis specification
GO:0010654Biological Processapical cell fate commitment
GO:0048825Biological Processcotyledon development
GO:0080167Biological Processresponse to karrikin
GO:0090451Biological Processcotyledon boundary formation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MFSEMFCTKN NTHVNPLYQL STILFLPTYL LLYKKSECFT SHGNNSKSIV VITSNNKIKY  60
SSGIGIDNRI VMESGNNNDE ELDMEMEMGG SNVNGNGGVA GSSSRWNPTK EQISMLENLY  120
KQGIKTPSAE EIQQITARLR AYGHIEGKNV FYWFQNHKAR QRQKQKQETF AYFNRFLHTP  180
QPFFSPPICP NAMCAPYYIP QAQGEIGFYH PHPKVLVPVG FRRSPSEKVV PTGMHQMQQR  240
ISDCCNSHYS NQETLDLFPL HPTGILEGKT TTTTDQVPSL ASVSADSSTD TPSAAASPDH  300
INEDHDHASP LNQPFFDFFT TSGQGSY
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in embryonic patterning. Required for apical embryo development after fertilization. Its specific localization to the apical daughter cell of the zygote, while WOX8 is confined to the basal cell, suggests that the asymmetric division of the plant zygote separates determinants of apical and basal cell fates. {ECO:0000269|PubMed:14711878}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN32118.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2352951e-139AC235295.1 Glycine max strain Williams 82 clone GM_WBb0059N17, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003540730.20.0WUSCHEL-related homeobox 2
RefseqXP_028194120.10.0WUSCHEL-related homeobox 2-like
SwissprotQ6X7K19e-54WOX2_ARATH; WUSCHEL-related homeobox 2
TrEMBLA0A0B2RJI50.0A0A0B2RJI5_GLYSO; WUSCHEL-related homeobox 2
TrEMBLK7LTC50.0K7LTC5_SOYBN; Uncharacterized protein
STRINGGLYMA12G06895.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF82563044
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59340.13e-51WUSCHEL related homeobox 2
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]
  2. Liang Z,Brown RC,Fletcher JC,Opsahl-Sorteberg HG
    Calpain-Mediated Positional Information Directs Cell Wall Orientation to Sustain Plant Stem Cell Activity, Growth and Development.
    Plant Cell Physiol., 2015. 56(9): p. 1855-66
    [PMID:26220906]
  3. Zhu T,Moschou PN,Alvarez JM,Sohlberg JJ,von Arnold S
    WUSCHEL-RELATED HOMEOBOX 2 is important for protoderm and suspensor development in the gymnosperm Norway spruce.
    BMC Plant Biol., 2016. 16: p. 19
    [PMID:26786587]
  4. Zhang Z,Tucker E,Hermann M,Laux T
    A Molecular Framework for the Embryonic Initiation of Shoot Meristem Stem Cells.
    Dev. Cell, 2017. 40(3): p. 264-277.e4
    [PMID:28171749]