PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN32075.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family NF-YC
Protein Properties Length: 186aa    MW: 20947.8 Da    PI: 10.4323
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN32075.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC32.22.4e-10831681499
       NF-YC  14 tdfknhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprd 99 
                 ++ k + +P+ ri+ ++k ++   ++s ea   + ++ e f+ ++t  ++  + + +++ l    +a +v++   +dfl d vp+ 
  KHN32075.1  83 EEAKMNVFPMNRIRTMIKGEDPEMRVSQEALFAINNTVEKFLEQFTQDAYAFCAQDRKKCLSYDHLAHVVSKQRRYDFLSDFVPER 168
                 5667889***********8888888**********************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471131.3E-1589168IPR009072Histone-fold
PfamPF008089.0E-1590152IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.101.2E-2390167IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 186 aa     Download sequence    Send to blast
MASSNTPKPE KKKSTKKSEI SKAEKKKTKN AEIPKTDGKT KKNKEISQEE NKKKIKKAKL  60
SNGTSKQRDE GSKKGVAAEG NGEEAKMNVF PMNRIRTMIK GEDPEMRVSQ EALFAINNTV  120
EKFLEQFTQD AYAFCAQDRK KCLSYDHLAH VVSKQRRYDF LSDFVPERVK AEDALRERSA  180
AGKGGS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0915290.0BT091529.1 Soybean clone JCVI-FLGm-8O17 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006591843.11e-133PREDICTED: uncharacterized protein LOC100500588 isoform X2
TrEMBLA0A0B2RFJ21e-134A0A0B2RFJ2_GLYSO; Chromatin accessibility complex protein 1
STRINGGLYMA12G07390.11e-121(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120163031
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07980.13e-28nuclear factor Y, subunit C10
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]