PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN31261.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family ARF
Protein Properties Length: 843aa    MW: 93884.5 Da    PI: 6.7571
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN31261.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B372.64.9e-23142243199
                 EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..E CS
          B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelv 93 
                 f+k+lt sd++++g +++ +++a+e+      + k++ +++l+ +d++ ++W++k+i+r++++r++l++GW+ Fv++++L +gD ++F   + +++el+
  KHN31261.1 142 FCKTLTASDTSTHGGFSVLRRHADEClppldmS-KQPPTQELVAKDLHANEWRFKHIFRGQPRRHLLQSGWSVFVSSKRLVAGDAFIFL--RGENGELR 237
                 99*****************************63.4445569************************************************..449999** PP

                 EEEE-S CS
          B3  94 vkvfrk 99 
                 v+v+r+
  KHN31261.1 238 VGVRRA 243
                 ***996 PP

2Auxin_resp121.75.3e-40268350183
  Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                 a+ha+st+++F+v+Y+Pr+s++eF+v++++++++lk+++s+GmRfkm+fe+e+++e+r++Gt+vg++d+dp rW++SkWr+Lk
  KHN31261.1 268 AWHAISTGTIFTVYYKPRTSPAEFIVPYDQYMESLKNNYSIGMRFKMRFEGEEAPEQRFTGTIVGIEDSDPKRWRDSKWRCLK 350
                 89*******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019368.89E-40138271IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.3E-40139257IPR015300DNA-binding pseudobarrel domain
CDDcd100171.44E-20140242No hitNo description
SMARTSM010192.9E-22142244IPR003340B3 DNA binding domain
PfamPF023626.9E-21142243IPR003340B3 DNA binding domain
PROSITE profilePS5086311.406142244IPR003340B3 DNA binding domain
PfamPF065078.3E-37268350IPR010525Auxin response factor
PROSITE profilePS5174523.127713795IPR000270PB1 domain
SuperFamilySSF542775.4E-10716790No hitNo description
PfamPF023092.5E-7754801IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 843 aa     Download sequence    Send to blast
MTSLEVTMKG NCLNHNDGGA TEPHSPSTAK DAEAALFREL WHACAGPLVT VPRERERVFY  60
FPQGHIEQVE ASTNQVADQH MPVYDLPPKI LCRVINVQLK AEPDTDEVFA QVTLLPEPNQ  120
DENAVEKEPP PPPPPRFHVH SFCKTLTASD TSTHGGFSVL RRHADECLPP LDMSKQPPTQ  180
ELVAKDLHAN EWRFKHIFRG QPRRHLLQSG WSVFVSSKRL VAGDAFIFLR GENGELRVGV  240
RRAMRQQGNV PSSVISSHSM HLGVLATAWH AISTGTIFTV YYKPRTSPAE FIVPYDQYME  300
SLKNNYSIGM RFKMRFEGEE APEQRFTGTI VGIEDSDPKR WRDSKWRCLK VRWDETSNTP  360
RPERVSPWKI EPALAPPALN PLSMPRPKRP RSNAVPSSPD SSVLTREASS KVSIDPSPAN  420
GFPRVLQGQE FSTLRGNFAE SNESDTAEKS VVWPPAAVDD EKMDVSTSRR YGSESWMSMG  480
RNEPTYSDLL SGFGASGDPS HLSLKDQMSP AYSARKQSLD HEGKLHMPHP WPVMPSSLSL  540
SILDSNTKGP AHGGDTTYKA RGNLRYSAFG EYPALHGHKV EHSHGNLMPP PPALLTQYQS  600
PCSRELMSKQ VSAKTCEAVK PKDGDCKLFG FSLISGPTLP EPSLSQRNVS EAADQMHLTA  660
HQQRTSENDE KLDHSKGSRP VDDIVVDDQD RPLRTSQLHT KDVQAKPLSG SARSCTKVHK  720
KGIALGRSVD LTKYSGYDEL VAELDQLFEF GGELLSTKKD WLIVFTDNEG DMMLVGDDPW  780
QEFCAMVRKI YIYPKEEIQK MSPGTLSSKN EENHSVTASE GADTKDVKCQ PHQKFNSENG  840
LDA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1783537218354Auxin response factor 1
4ldw_A1e-1783537218354Auxin response factor 1
4ldw_B1e-1783537218354Auxin response factor 1
4ldx_A1e-1783537218354Auxin response factor 1
4ldx_B1e-1783537218354Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. Promotes flowering, stamen development, floral organ abscission and fruit dehiscence. Functions independently of ethylene and cytokinin response pathways. May act as a repressor of cell division and organ growth. {ECO:0000269|PubMed:12036261, ECO:0000269|PubMed:15960614, ECO:0000269|PubMed:16176952, ECO:0000269|PubMed:16339187}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN31261.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003523174.10.0auxin response factor 2B
RefseqXP_028229492.10.0auxin response factor 2B-like
SwissprotQ94JM30.0ARFB_ARATH; Auxin response factor 2
TrEMBLA0A445L2R50.0A0A445L2R5_GLYSO; Auxin response factor
TrEMBLI1JXQ20.0I1JXQ2_SOYBN; Auxin response factor
STRINGGLYMA04G37760.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF32813366
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62000.30.0auxin response factor 2
Publications ? help Back to Top
  1. Chao WS,Doğramaci M,Foley ME,Horvath DP,Anderson JV
    Selection and validation of endogenous reference genes for qRT-PCR analysis in leafy spurge (Euphorbia esula).
    PLoS ONE, 2012. 7(8): p. e42839
    [PMID:22916167]
  2. Ozerova LV,Krasnikova MS,Troitsky AV,Solovyev AG,Morozov SY
    TAS3 Genes for small ta-siARF RNAs in plants belonging to subtribe Senecioninae: occurrence of prematurely terminated RNA precursors.
    Mol. Gen. Mikrobiol. Virusol., 2013.
    [PMID:24003511]
  3. Li C, et al.
    Ectopic expression of a maize hybrid down-regulated gene ZmARF25 decreases organ size by affecting cellular proliferation in Arabidopsis.
    PLoS ONE, 2014. 9(4): p. e94830
    [PMID:24756087]
  4. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]
  5. Lyons R, et al.
    Fusarium oxysporum triggers tissue-specific transcriptional reprogramming in Arabidopsis thaliana.
    PLoS ONE, 2015. 10(4): p. e0121902
    [PMID:25849296]
  6. Roodbarkelari F,Du F,Truernit E,Laux T
    ZLL/AGO10 maintains shoot meristem stem cells during Arabidopsis embryogenesis by down-regulating ARF2-mediated auxin response.
    BMC Biol., 2015. 13: p. 74
    [PMID:26358077]
  7. Meng LS,Wang ZB,Yao SQ,Liu A
    The ARF2-ANT-COR15A gene cascade regulates ABA-signaling-mediated resistance of large seeds to drought in Arabidopsis.
    J. Cell. Sci., 2015. 128(21): p. 3922-32
    [PMID:26395398]
  8. Zhao S,Zhang ML,Ma TL,Wang Y
    Phosphorylation of ARF2 Relieves Its Repression of Transcription of the K+ Transporter Gene HAK5 in Response to Low Potassium Stress.
    Plant Cell, 2016. 28(12): p. 3005-3019
    [PMID:27895227]
  9. Promchuea S,Zhu Y,Chen Z,Zhang J,Gong Z
    ARF2 coordinates with PLETHORAs and PINs to orchestrate ABA-mediated root meristem activity in Arabidopsis .
    J Integr Plant Biol, 2017. 59(1): p. 30-43
    [PMID:28074634]
  10. Wójcikowska B,Gaj MD
    Expression profiling of AUXIN RESPONSE FACTOR genes during somatic embryogenesis induction in Arabidopsis.
    Plant Cell Rep., 2017. 36(6): p. 843-858
    [PMID:28255787]
  11. Sanz-Fernández M, et al.
    Screening Arabidopsis mutants in genes useful for phytoremediation.
    J. Hazard. Mater., 2017. 335: p. 143-151
    [PMID:28441590]
  12. Zhang M,Hu X,Zhu M,Xu M,Wang L
    Transcription factors NF-YA2 and NF-YA10 regulate leaf growth via auxin signaling in Arabidopsis.
    Sci Rep, 2017. 7(1): p. 1395
    [PMID:28469131]
  13. Guan C, et al.
    Spatial Auxin Signaling Controls Leaf Flattening in Arabidopsis.
    Curr. Biol., 2017. 27(19): p. 2940-2950.e4
    [PMID:28943086]
  14. Liu Z, et al.
    ARF2-ARF4 and ARF5 are Essential for Female and Male Gametophyte Development in Arabidopsis.
    Plant Cell Physiol., 2018. 59(1): p. 179-189
    [PMID:29145642]
  15. Sarkar Das S, et al.
    Expression dynamics of miRNAs and their targets in seed germination conditions reveals miRNA-ta-siRNA crosstalk as regulator of seed germination.
    Sci Rep, 2018. 8(1): p. 1233
    [PMID:29352229]