PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN30180.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 311aa    MW: 33828.9 Da    PI: 9.6118
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN30180.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.21.8e-3870128462
      zf-Dof   4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                   lkcprC+stntkfCy+nnyslsqPr+fCk+CrryWt+GGalrnvPvGgg+r+nkk++
  KHN30180.1  70 GVLKCPRCESTNTKFCYFNNYSLSQPRHFCKTCRRYWTRGGALRNVPVGGGCRRNKKNK 128
                 5789****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-2855121IPR003851Zinc finger, Dof-type
PfamPF027019.3E-3371126IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.53472126IPR003851Zinc finger, Dof-type
PROSITE patternPS01361074110IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MVFSSIPVYL DPPNWQQQQQ NQHQANGSNS PHELLPPLPQ PPQAPHVGVE SEQIRSGLMA  60
DRAKIPAPEG VLKCPRCEST NTKFCYFNNY SLSQPRHFCK TCRRYWTRGG ALRNVPVGGG  120
CRRNKKNKRS RSKSPVSTEK PSLPNNTSAI PELIGRFPQP FMASLQSMNR YGVGINTGVN  180
LREIQAQNAS QMEFQIGGLG NGSSVATAGG GGGGGGVEQW RFQQFPFLNG FESTSAASNS  240
YPFQSEIVEG LVGDINATSS RITQLPARVK MEYNGGLNLS RSPLNVSENS NHCYSWTDLS  300
GLASSSASHL L
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003547369.10.0PREDICTED: dof zinc finger protein DOF3.6-like
TrEMBLA0A0B2R9E80.0A0A0B2R9E8_GLYSO; Dof zinc finger protein DOF3.6
STRINGGLYMA15G04430.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65634143
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37590.12e-39DNA binding with one finger 2.4
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]