PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN30161.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GRAS
Protein Properties Length: 622aa    MW: 70952.2 Da    PI: 6.3847
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN30161.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS361.11.5e-1102486191373
        GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaN 99 
                 l++lL+ cA+a++s++ + a++l++++ +++sp+ + +qRla+yf +AL+arl +++ ++++al++++ts    ++ ++a++++  v+P+ k++ + aN
  KHN30161.1 248 LRTLLMLCAQAIASDNPSSAKQLVKQIMQHSSPTCNETQRLAHYFGNALEARLDGTGYKVCSALSSKRTS---AKDMIKAYHVYASVCPFEKLAIIFAN 343
                 5789***************************************************999999999999998...99************************ PP

        GRAS 100 qaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrv 196
                 + I +    ++++HiiDf+i +G++WpaL+  L+ R++gpp+lRiTg++ p++g   +e++ etg+rLa+f+++++vpfefn+ +a+r++++++e+L++
  KHN30161.1 344 NSIWNPSVDAKAIHIIDFGIRYGFKWPALISRLSRRSGGPPKLRITGIDVPQPGlrPQERVLETGRRLANFCKRFNVPFEFNA-IAQRWDTIRVEDLKI 441
                 ********************************************************9**************************.7************** PP

        GRAS 197 kpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreiv 295
                 +p+E +aVn+ +q ++llde+v l++ rd+vL+l+k+ +P+++v+   + +++ + F+ rf eal +y+alfd+l+++++r++  r + E+el+greiv
  KHN30161.1 442 EPNEFVAVNCLFQFEHLLDETVVLNNSRDAVLRLIKNANPDIFVHGIVNGSYDVPFFVSRFREALFHYTALFDMLDTNVARQDPMRLMFEKELFGREIV 540
                 *************************************************************************************************** PP

        GRAS 296 nvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaW 373
                 n++aceg+er+er +t+++W+ r ++ GF+ +pl++++  + k  lr  + ++ + +e + +++++gWk+r L++ S+W
  KHN30161.1 541 NIIACEGFERVERPQTYKQWQLRNMRNGFRLLPLDHRIIGKLKDRLRDDAhNNNFLLEVDGDWVLQGWKGRILYASSCW 619
                 **********************************************99887999************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098562.064222599IPR005202Transcription factor GRAS
PfamPF035145.4E-108248619IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 622 aa     Download sequence    Send to blast
MLMEDDTEER YSMFHDSLAL QHTERSFLEA INHNYPSPSY SSSTHYHLDN YPSVESPEPC  60
LSACSADNIT FSASSSCASN NTTSSSEFPL RSLYPLLPDT TDEFVFHSNS TQSTINTPFG  120
FFDNPLAEIF ERRVDLGTLF LPANTPFSSS FTKVPHVVIK TEAEEGDHFL TGRKQREREE  180
YEAADGRSRK QSAAHMDESE LSELFDKVVL GTDLRKRVPP NTTHKTTILT NMLYGGDVWE  240
NDDQVVDLRT LLMLCAQAIA SDNPSSAKQL VKQIMQHSSP TCNETQRLAH YFGNALEARL  300
DGTGYKVCSA LSSKRTSAKD MIKAYHVYAS VCPFEKLAII FANNSIWNPS VDAKAIHIID  360
FGIRYGFKWP ALISRLSRRS GGPPKLRITG IDVPQPGLRP QERVLETGRR LANFCKRFNV  420
PFEFNAIAQR WDTIRVEDLK IEPNEFVAVN CLFQFEHLLD ETVVLNNSRD AVLRLIKNAN  480
PDIFVHGIVN GSYDVPFFVS RFREALFHYT ALFDMLDTNV ARQDPMRLMF EKELFGREIV  540
NIIACEGFER VERPQTYKQW QLRNMRNGFR LLPLDHRIIG KLKDRLRDDA HNNNFLLEVD  600
GDWVLQGWKG RILYASSCWV PA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-482526198374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003542035.10.0PREDICTED: scarecrow-like protein 14
RefseqXP_014621572.10.0PREDICTED: scarecrow-like protein 14
SwissprotQ9XE580.0SCL14_ARATH; Scarecrow-like protein 14
TrEMBLI1M4X60.0I1M4X6_SOYBN; Uncharacterized protein
STRINGGLYMA13G41220.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13134339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.10.0SCARECROW-like 14