PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN30159.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GRAS
Protein Properties Length: 723aa    MW: 81845.4 Da    PI: 5.8
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN30159.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS380.61.9e-1163487201373
        GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaN 99 
                 l++lL+ cA+avss+d++ a++lL+++++++s  gd+ qRla+y+++AL+arl++  ++++ ++   + ++ ++++ l a+++f  ++P+ kf+h+ aN
  KHN30159.1 348 LRTLLILCAQAVSSSDNRTANELLKQIRQHSSALGDASQRLAHYVANALEARLVG--DGTATQIFYMSYKKFTTTDFLRAYQVFISACPFKKFAHFFAN 444
                 5789**************************************************9..555444544444445699************************ PP

        GRAS 100 qaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrv 196
                 ++I++ ++g+e++HiiDf+i +G+QWp L++ L+ Rp+gpp+lRiTg++ p++g   +e++eetg+rLak++++++vpfe+++++++++e++++e+L++
  KHN30159.1 445 KMIMKTADGAETLHIIDFGILYGFQWPILIKFLSRRPGGPPKLRITGIEYPQPGfrPTERIEETGRRLAKYCKRFNVPFEYKAIASRNWETIQIEDLKI 543
                 *****************************************************9*****************************9999************ PP

        GRAS 197 kpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreiv 295
                 +++E laVn+ ++ ++lldes +++s+r++vL+l+++++P+++v++  + ++n++ Fl+rf eal +ys+++d++++ ++re+e+r ++Ere+lgrei+
  KHN30159.1 544 ERNELLAVNCLVRFKNLLDESIEVNSPRNAVLNLIRKMKPDIFVHSVVNGSYNAPFFLTRFREALFHYSSIYDMFDTLISRENEWRLMLEREFLGREIM 642
                 *************************************************************************************************** PP

        GRAS 296 nvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                 nvvace  er+er et+++W++r ++aGFk++pl+++++++ +  lr+ + + +  +e+ +++++gWk+r L++ ++W
  KHN30159.1 643 NVVACEALERVERPETYKQWQARNTRAGFKQLPLDKEIMTKFRGKLREWYHRDFVFDEDGNWMLQGWKGRILYASTCW 720
                 **************************************************999************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098568.259322701IPR005202Transcription factor GRAS
PfamPF035146.5E-114348720IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 723 aa     Download sequence    Send to blast
MDPNFIISGY DFDESNHWDL NGHYANLLND AFSDVGPLGL SQNAILNSEP FVSSSASAAT  60
DPAATTATLA DPSPEEDTDF SETFKFISQI LLEENFEQKP CMCYDPLTLQ HTEKSFYEAL  120
ELEPSLPLSP NQHPLESPDG NSSNSISDSA NSHDLKPSSP NTPVSDALHS SSHAPSFVVP  180
PHALNKINDG TVDLDSSVTK LLAENIFSDT DSMLQFKRGL EEASKFLPRR PQLFTGLEST  240
AVSAEPKGKG VALKMENSIG VRSRKNHARQ DEEEEEERSN KQSAVSAVCV EEESEISEIF  300
DRVLLSVENV PLCAEKNGSV AQAEKSNLSD GGKVRSKRQG RKKETVDLRT LLILCAQAVS  360
SSDNRTANEL LKQIRQHSSA LGDASQRLAH YVANALEARL VGDGTATQIF YMSYKKFTTT  420
DFLRAYQVFI SACPFKKFAH FFANKMIMKT ADGAETLHII DFGILYGFQW PILIKFLSRR  480
PGGPPKLRIT GIEYPQPGFR PTERIEETGR RLAKYCKRFN VPFEYKAIAS RNWETIQIED  540
LKIERNELLA VNCLVRFKNL LDESIEVNSP RNAVLNLIRK MKPDIFVHSV VNGSYNAPFF  600
LTRFREALFH YSSIYDMFDT LISRENEWRL MLEREFLGRE IMNVVACEAL ERVERPETYK  660
QWQARNTRAG FKQLPLDKEI MTKFRGKLRE WYHRDFVFDE DGNWMLQGWK GRILYASTCW  720
VPA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-463526768328GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150400.0AP015040.1 Vigna angularis var. angularis DNA, chromosome 7, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014497663.10.0PREDICTED: scarecrow-like protein 14
SwissprotQ9XE580.0SCL14_ARATH; Scarecrow-like protein 14
TrEMBLA0A0B2RCQ90.0A0A0B2RCQ9_GLYSO; Scarecrow-like protein 14
STRINGGLYMA13G41240.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13134339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.10.0SCARECROW-like 14
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]