PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN30157.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GRAS
Protein Properties Length: 666aa    MW: 74737.9 Da    PI: 6.0305
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN30157.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS371.41.2e-1132986643374
        GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqa 101
                 +lL++cA+av+s d+++a+ lL+++++++s  gd +qRla+yf+++L+ rla  ++      + ++ + ++s++ l+a+kl++  sP+ ++++ +a ++
  KHN30157.1 298 TLLTQCAQAVASFDQRNANDLLSQIRQHSSAFGDGLQRLAHYFANGLQIRLAA-GTP-----SYTPLEGTTSADMLKAYKLYVTSSPLQRLTNYLATKT 390
                 69**************************************************9.333.....33333334489************************** PP

        GRAS 102 IleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkp 198
                 I+  v +e  vHiiDf+i +G+QWp+L+++L++R +gpp+lRiTg++ p++g   +e++eetg+rLa+++++++vpfe+n  +a+++e+++l +L++++
  KHN30157.1 391 IVSLVGNEGSVHIIDFGICYGFQWPCLIKKLSERHGGPPRLRITGIELPQPGfrPAERVEETGRRLANYCKKFKVPFEYNC-LAQKWETIKLADLKIDR 488
                 ***************************************************9*****************************.6**************** PP

        GRAS 199 gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnv 297
                 +E+++V++ ++l++l+de+v+++s+rd+vLkl+++++P+++++   +  +n++ Fl+rf eal+++s+lfd++ea++pre+ er+++E+ l+gr++ nv
  KHN30157.1 489 NEVTVVSCFYRLKNLPDETVDVKSPRDAVLKLIRRINPNMFIHGVVNGTYNAPFFLTRFREALYHFSSLFDMFEANVPREDPERVMLENGLFGRDAINV 587
                 *************************************************************************************************** PP

        GRAS 298 vacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                 +acegaer+er et+++W+ r ++aGFk+v+++ + +++ k +++k +++ + v e+ +++ lgWk+r L ++SaW+
  KHN30157.1 588 IACEGAERVERPETYKQWQVRNQRAGFKQVRFDPQLVNDEKEMVKKEYQKDFVVAEDGKWVWLGWKGRILNAISAWT 664
                 ************************************************999*************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098562.865270644IPR005202Transcription factor GRAS
PfamPF035144.2E-111298664IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
Sequence ? help Back to Top
Protein Sequence    Length: 666 aa     Download sequence    Send to blast
MSSNFLVEFN MNSLVQNFGG PISVFSNQDQ VEKGFDFEFD DSSSPSSGTS SGGESTEIHK  60
RHTHGRGRRL SNPILRYISD ILMDEEDDLE CKPCMLQECL RLQAAEKSFH DALLHQNPSS  120
CFSDENYGRT VSFESCTTDN SCESELVNGV GEFDSSFLQL QTPLVHDPFG ESQAAGYFHD  180
GTWNLFQSQS QTKPLMVEEG SSASAPREKR SHGMDDYASH EQEGRRGSKV SAVFSDESES  240
PEILDEVLLC QSGRSQALLC AATEPSQSVD LGGSNGKATR SRSKKVSAKA GTAVDLWTLL  300
TQCAQAVASF DQRNANDLLS QIRQHSSAFG DGLQRLAHYF ANGLQIRLAA GTPSYTPLEG  360
TTSADMLKAY KLYVTSSPLQ RLTNYLATKT IVSLVGNEGS VHIIDFGICY GFQWPCLIKK  420
LSERHGGPPR LRITGIELPQ PGFRPAERVE ETGRRLANYC KKFKVPFEYN CLAQKWETIK  480
LADLKIDRNE VTVVSCFYRL KNLPDETVDV KSPRDAVLKL IRRINPNMFI HGVVNGTYNA  540
PFFLTRFREA LYHFSSLFDM FEANVPREDP ERVMLENGLF GRDAINVIAC EGAERVERPE  600
TYKQWQVRNQ RAGFKQVRFD PQLVNDEKEM VKKEYQKDFV VAEDGKWVWL GWKGRILNAI  660
SAWTPA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-433006638374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014497665.10.0PREDICTED: scarecrow-like protein 11
TrEMBLA0A0B2RE740.0A0A0B2RE74_GLYSO; Scarecrow-like protein 33
STRINGGLYMA13G41261.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13134339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59450.11e-167GRAS family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]