PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN30114.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family EIL
Protein Properties Length: 591aa    MW: 66069 Da    PI: 6.1441
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN30114.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3437.99.4e-134383621303
                 XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
        EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraWWkekv 99 
                 eel++rmwkd+++lkrlke++k   e+++a ++++k ++s++qarrkkmsraQDgiLkYMlk mevc+a+GfvYgiipekgkpv+g+sd++raWWkekv
  KHN30114.1  38 EELERRMWKDRIKLKRLKEKQKL--EAQQA-AEKQKPRQSSDQARRKKMSRAQDGILKYMLKLMEVCKARGFVYGIIPEKGKPVSGSSDNIRAWWKEKV 133
                 8****************999986..45665.99****************************************************************** PP

                 XXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT--TT--.-----G CS
        EIN3 100 efdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelglskdqgtppykkp 198
                 +fd+ngpaai+ky+a++l++s+++++  ++ ++++ l++lqD+tlgSLLsalmqhcdppqr++plekg++pPWWP+G+e+ww++l l++ q+ ppykkp
  KHN30114.1 134 RFDKNGPAAIAKYEADCLAMSEADNS--RNGNSQSILQDLQDATLGSLLSALMQHCDPPQRKYPLEKGIPPPWWPNGNEDWWSQLNLPHGQS-PPYKKP 229
                 *********************99988..78999999*******************************************************9.9***** PP

                 GG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXXXX.........XXXXXXXXXXXXXXXXXXXXXXX CS
        EIN3 199 hdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsahss.........slrkqspkvtlsceqkedvegkk 288
                 hdlkk+wkv+vLtavikhmsp+i++ir+++rqsk+lqdkm+akes+++l vl++ee+++++ s+++           +  ++++   s+ +++dv+g++
  KHN30114.1 230 HDLKKMWKVGVLTAVIKHMSPNIAKIRKHVRQSKCLQDKMTAKESAIWLGVLSREEALIRQPSSDNGtsgitgvppGVPVENKQAATSSASNYDVDGTD 328
                 *****************************************************************44456777776444488888888899*****888 PP

                 XXX.XXXXXXXXXX...................X CS
        EIN3 289 eskikhvqavktta...................g 303
                 +   + ++++++++                   +
  KHN30114.1 329 DGIGSVSSKENRRNqfmdtepsdnlrrvrksgqD 362
                 8888888888887755655555544444444321 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048733.5E-12738285No hitNo description
Gene3DG3DSA:1.10.3180.102.4E-71160293IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167681.44E-61166289IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0042762Biological Processregulation of sulfur metabolic process
GO:0071281Biological Processcellular response to iron ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 591 aa     Download sequence    Send to blast
MGEMEEIGAD VCSDIEVDDI RCPNIAEKDV SDEEIEAEEL ERRMWKDRIK LKRLKEKQKL  60
EAQQAAEKQK PRQSSDQARR KKMSRAQDGI LKYMLKLMEV CKARGFVYGI IPEKGKPVSG  120
SSDNIRAWWK EKVRFDKNGP AAIAKYEADC LAMSEADNSR NGNSQSILQD LQDATLGSLL  180
SALMQHCDPP QRKYPLEKGI PPPWWPNGNE DWWSQLNLPH GQSPPYKKPH DLKKMWKVGV  240
LTAVIKHMSP NIAKIRKHVR QSKCLQDKMT AKESAIWLGV LSREEALIRQ PSSDNGTSGI  300
TGVPPGVPVE NKQAATSSAS NYDVDGTDDG IGSVSSKENR RNQFMDTEPS DNLRRVRKSG  360
QDTDQAKKQP RPKKPRRAND KPPAQSDNEI SLVEPRSNGL NMNLTEAQMG GVQIHGNEQS  420
NETDSAARPL ERGLEVSAQL PAPEVDHYSY LHTNNLISSA SMYMSGRPMH YPELQNPDMH  480
HETTYNLYNP AAGYEPGQDG QQLHSANNEA VRPENVVVSL QGVHMKGDGI NGGDLQYFGK  540
DAFQNDLDRP MDHSFFGSPL SSMSLDFGGL GSPFHLDDFM CDDEMIQYFG A
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wij_A4e-721652969140ETHYLENE-INSENSITIVE3-like 3 protein
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may be involved in the ethylene response pathway. {ECO:0000269|PubMed:9215635, ECO:0000269|PubMed:9851977}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00233DAPTransfer from AT1G73730Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN30114.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150400.0AP015040.1 Vigna angularis var. angularis DNA, chromosome 7, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028190439.10.0ETHYLENE INSENSITIVE 3-like 3 protein
SwissprotO231160.0EIL3_ARATH; ETHYLENE INSENSITIVE 3-like 3 protein
TrEMBLA0A445IEA00.0A0A445IEA0_GLYSO; ETHYLENE INSENSITIVE 3-like 3 protein isoform A
STRINGGLYMA13G41751.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF32234200
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73730.11e-175ETHYLENE-INSENSITIVE3-like 3
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]
  2. Frerigmann H,Gigolashvili T
    Update on the role of R2R3-MYBs in the regulation of glucosinolates upon sulfur deficiency.
    Front Plant Sci, 2014. 5: p. 626
    [PMID:25426131]
  3. Zheng ZL,Zhang B,Leustek T
    Transceptors at the boundary of nutrient transporters and receptors: a new role for Arabidopsis SULTR1;2 in sulfur sensing.
    Front Plant Sci, 2014. 5: p. 710
    [PMID:25566284]
  4. Panda SK,Sunkar R
    Nutrient- and other stress-responsive microRNAs in plants: Role for thiol-based redox signaling.
    Plant Signal Behav, 2015. 10(4): p. e1010916
    [PMID:25912823]
  5. WawrzyƄska A,Sirko A
    EIN3 interferes with the sulfur deficiency signaling in Arabidopsis thaliana through direct interaction with the SLIM1 transcription factor.
    Plant Sci., 2016. 253: p. 50-57
    [PMID:27968996]