PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN29725.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB_related
Protein Properties Length: 225aa    MW: 24773.8 Da    PI: 10.1117
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN29725.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.31.9e-14113157347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+++++ + ++lG+g+W+ I+r + ++Rt+ q+ s+ qky
       KHN29725.1 113 PWTEEEHQIFLIGLEKLGKGNWRGISRSFVTTRTPTQVASHAQKY 157
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501588.614522IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129418.987106162IPR017930Myb domain
SuperFamilySSF466897.18E-17108162IPR009057Homeodomain-like
TIGRFAMsTIGR015578.3E-17109161IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.3E-11110156IPR009057Homeodomain-like
SMARTSM007171.1E-9110160IPR001005SANT/Myb domain
PfamPF002498.1E-12113157IPR001005SANT/Myb domain
CDDcd001673.27E-9113157No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    Send to blast
MGIARKCSYC GNLGHNARTC KSTLSQGQLK LFGVQLDVSS FSSSSNSFSS SPSYSAMKRS  60
FSTNYLLSSW PSSSVPSSFS SPSLLGANEN LDGYLLNANS LISTIQDAKK GVPWTEEEHQ  120
IFLIGLEKLG KGNWRGISRS FVTTRTPTQV ASHAQKYYLR QSQNSFNKRK HRPSLLDNWL  180
SLRPHSVLNW ATTSTSTNCT VQRANPDLDL KLATPTPFEL PVADT
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN29725.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003523642.11e-165probable transcription factor At5g61620 isoform X1
RefseqXP_028227792.11e-165probable transcription factor At5g61620 isoform X1
TrEMBLA0A445KWJ71e-163A0A445KWJ7_GLYSO; Putative transcription factor
TrEMBLI1JTW41e-163I1JTW4_SOYBN; Uncharacterized protein
STRINGGLYMA04G05390.11e-164(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF151421013
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56840.14e-42MYB_related family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]