PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN29615.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family ARR-B
Protein Properties Length: 650aa    MW: 71857.7 Da    PI: 6.8237
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN29615.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like60.24.2e-19204247145
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtleh 45 
                 kpr++W+ +LH++Fv av+qL G++kA+Pk+il+lm+v+ Lt+e+
  KHN29615.1 204 KPRVVWSVDLHRKFVAAVNQL-GIDKAVPKKILDLMNVEKLTREN 247
                 79*******************.********************987 PP

2Response_reg79.61.1e-26201281109
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                   vl vdD+p+ + +l+++l++ +y +v+++ ++ +al+ll+e++  +Dl++ D+ mp+mdG++ll+     e++lp+i+++a+g+ +++ + ++ Ga 
    KHN29615.1  20 VLAVDDDPTCLLVLKTLLQRCQY-HVTTTNQAIKALALLREHKdkFDLVISDVHMPDMDGFKLLELVGL-EMDLPVIMLSANGDTKMVMKGISHGAC 114
                   799********************.***************999889*******************87754.558************************ PP

                   EEEESS--HHHHHH CS
  Response_reg  96 dflsKpfdpeelvk 109
                   d+l Kp+ +eel +
    KHN29615.1 115 DYLLKPVRMEELKN 128
                   ***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363926.1E-1551650IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23001.4E-4317152No hitNo description
SuperFamilySSF521728.4E-3717141IPR011006CheY-like superfamily
SMARTSM004482.7E-3218130IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011044.07419134IPR001789Signal transduction response regulator, receiver domain
PfamPF000725.4E-2420128IPR001789Signal transduction response regulator, receiver domain
CDDcd001565.19E-2821134No hitNo description
Gene3DG3DSA:1.10.10.605.0E-20201256IPR009057Homeodomain-like
SuperFamilySSF466892.51E-11202255IPR009057Homeodomain-like
TIGRFAMsTIGR015578.1E-16204247IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 650 aa     Download sequence    Send to blast
MTVEKKRNDS GDEFPVGMRV LAVDDDPTCL LVLKTLLQRC QYHVTTTNQA IKALALLREH  60
KDKFDLVISD VHMPDMDGFK LLELVGLEMD LPVIMLSANG DTKMVMKGIS HGACDYLLKP  120
VRMEELKNIW QHVIRRKKFD SKEKNKTSNL DKPTSNSGNG LGSSGTGNSD QNEKLTKKRK  180
DQDEDEDEDQ ENDLDNEDPS AQKKPRVVWS VDLHRKFVAA VNQLGIDKAV PKKILDLMNV  240
EKLTRENKYR LYLKRISCVA NQQANMVAAL GVADPSYLRM SSVSGVGHVQ TLSGSGQLHN  300
NNFRSFPPSG IINRLNTPAG LNVHGFPSGV LQLSQSQNLN NANDHHKFQS VIVPVNQNGV  360
QGMTVSVGLD QLQNNKVVMS VQNLTTVFDA KTTFPIPNKL PDPRPKITNS VSHTSDVHFS  420
NNALMLEPRP QGSQGSVRIG TLSSSVASQH SEFSLSLLDQ GRYSDNWTSA VQPSVIQTNF  480
FPPSECFRQT NIPPADNMAS VPLQGGNLSG PSITSLSRQS HDSMTEMHSE GMTFTNRPGH  540
TSSNVPFQGW DDHNQDATHH SNIMSINSLT PVNGAAVQAG HAATNSVLHR NLDFNYCDPL  600
QMKHEGFVEL TDETLLKQHQ GNTMDQQKSQ ENHFSNNLGS LEDLVSSMMK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-19200257164ARR10-B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN29615.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0938360.0BT093836.1 Soybean clone JCVI-FLGm-24O12 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014629984.10.0two-component response regulator ARR12 isoform X1
RefseqXP_028227940.10.0two-component response regulator ARR12-like isoform X1
SwissprotB8AEH11e-136ORR23_ORYSI; Two-component response regulator ORR23
SwissprotQ6K8X61e-136ORR23_ORYSJ; Two-component response regulator ORR23
TrEMBLA0A445KWD90.0A0A445KWD9_GLYSO; Two-component response regulator
TrEMBLI1JU860.0I1JU86_SOYBN; Two-component response regulator
STRINGGLYMA04G06650.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-119response regulator 12
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]