PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN29080.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family EIL
Protein Properties Length: 453aa    MW: 52226.7 Da    PI: 4.8832
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN29080.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3395.95.3e-121283542353
                 XXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
        EIN3   2 elkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraWWkekve 100
                  lkkrmwkd++ll+++ke++ +    +e+ ++++     +e++rrkkmsraQD++LkYM+k+mevcnaqGfvYgi+pekgkpv+g+sdsLr+WWkekv+
  KHN29080.1  28 QLKKRMWKDRILLQKMKEKRPK----EEP-VQEA----KQEASRRKKMSRAQDSVLKYMMKIMEVCNAQGFVYGIVPEKGKPVTGSSDSLREWWKEKVK 117
                 69************99999997....567.4443....48*********************************************************** PP

                 XXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT.--TT--.-----G CS
        EIN3 101 fdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelg.lskdqgtppykkp 198
                 fd+n+p  i++y +   +l+ +++l  ++ss+ h l++lqDTtl+SLLsalmqhc ppqrrfple+g++pPWWP G e wwge+g l++++g+ppykkp
  KHN29080.1 118 FDQNAPSSIAEYLP---LLE-RDEL--DPSSYIHLLNDLQDTTLSSLLSALMQHCIPPQRRFPLERGLAPPWWPRGAENWWGEQGfLAHEHGPPPYKKP 210
                 ************33...444.4444..69********************************************************9999999******* PP

                 GG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.XXXXX CS
        EIN3 199 hdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsahssslrkqspkvtlsceqkedvegkkeskikhvqa 297
                 hdlkkawkvs+L+avikhmsp++ ++r+++ qsk lqdkm+ ++++++++v+nqee +++            ++ +++s+++++d++ + es+++++  
  KHN29080.1 211 HDLKKAWKVSLLAAVIKHMSPDLYKLRRSVTQSKTLQDKMTTRDTATWSKVMNQEETLLQ----------LANKCLKISSSEEDDKN-ECESSTSSSTI 298
                 *******************************************************98662..........35667778887666655.33333355555 PP

                 XXXXX.XXXXXXXXXXXXXXXXXXXXX......XXXXXXX.XXXXXXXXXXXXXXXX CS
        EIN3 298 vktta.gfpvvrkrkkkpsesakvsskevsrtcqssqfrgsetelifadknsisqne 353
                  ++ +     ++krk+  + +  + + +  + cq  q+++se+ ++f dkn + ++e
  KHN29080.1 299 IHEGShLGGSIEKRKSDLVFDLDAVIDK-LYACQYYQCPQSEMGMGFLDKNTRMNHE 354
                 5554413345666766766666666665.6***********************9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048738.1E-11328266No hitNo description
Gene3DG3DSA:1.10.3180.102.2E-63142270IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167686.67E-55144269IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 453 aa     Download sequence    Send to blast
MVEIHEEINP FDQEENEDIG EEEIDYDQLK KRMWKDRILL QKMKEKRPKE EPVQEAKQEA  60
SRRKKMSRAQ DSVLKYMMKI MEVCNAQGFV YGIVPEKGKP VTGSSDSLRE WWKEKVKFDQ  120
NAPSSIAEYL PLLERDELDP SSYIHLLNDL QDTTLSSLLS ALMQHCIPPQ RRFPLERGLA  180
PPWWPRGAEN WWGEQGFLAH EHGPPPYKKP HDLKKAWKVS LLAAVIKHMS PDLYKLRRSV  240
TQSKTLQDKM TTRDTATWSK VMNQEETLLQ LANKCLKISS SEEDDKNECE SSTSSSTIIH  300
EGSHLGGSIE KRKSDLVFDL DAVIDKLYAC QYYQCPQSEM GMGFLDKNTR MNHESLCAYR  360
TNEGQRVLLQ DSLSNDTQNE NNNLVGHLIN DEFRDIAGKT SEEDYGGLWP NSLEDLDLQA  420
ALNQMDMDLN PNPEQDTPHG QDVTSIWDLA YKY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A8e-551422681126Protein ETHYLENE INSENSITIVE 3
4zds_B8e-551422681126Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor that may be involved in the ethylene response pathway. {ECO:0000250}.
UniProtPutative transcription factor that may be involved in the ethylene response pathway. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN29080.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028247060.10.0putative ETHYLENE INSENSITIVE 3-like 4 protein
SwissprotQ9FJQ51e-131EIL5_ARATH; ETHYLENE INSENSITIVE 3-like 5 protein
SwissprotQ9LX161e-131EIL4_ARATH; Putative ETHYLENE INSENSITIVE 3-like 4 protein
TrEMBLA0A445JEC80.0A0A445JEC8_GLYSO; Putative ETHYLENE INSENSITIVE 3-like 4 protein isoform A
STRINGGLYMA08G14630.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF32234200
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G10120.11e-115EIL family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]
  3. Jeong HJ,Choi JY,Shin HY,Bae JM,Shin JS
    Seed-specific expression of seven Arabidopsis promoters.
    Gene, 2014. 553(1): p. 17-23
    [PMID:25261846]