PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN28800.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 482aa    MW: 52520.9 Da    PI: 6.9816
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN28800.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.12e-38131191262
      zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                 ++k l+cprC+s++tkfCyynny+++qPr+fCk+C+ryWt+GG++rnvP G+grrknk+ss
  KHN28800.1 131 PDKVLPCPRCNSMETKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPAGAGRRKNKNSS 191
                 78999*****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074789.0E-30131188IPR003851Zinc finger, Dof-type
PfamPF027012.0E-31132189IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.537135189IPR003851Zinc finger, Dof-type
PROSITE patternPS013610137173IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 482 aa     Download sequence    Send to blast
MSEVKDPAIK LFGRTISLPH THINDSFSSA SASGPACAPS SSSSPREVTS SATQQQHEPE  60
EPSRKVLTSS QDDDDASHQT TEDLKSSTTS SGIFENPKTP SAETETSIPK SSTNGEKSEK  120
SASEEKTLKK PDKVLPCPRC NSMETKFCYY NNYNVNQPRH FCKNCQRYWT AGGTMRNVPA  180
GAGRRKNKNS SATVSHYRHI MFSEGLQGAT LNAPNGLHNA VMTFGPDSPL CDTMASMLNI  240
AERAQSCVPN GFHVTEPNSF VSYRKEEEEE DGTSGHSTGV NSVATTSTLS HSGSHESLDK  300
KVVEGFTPQF PYFPSAPWPY PIPPPTFFPQ GYPLSLYTTP AYWSYMPPSW NNNISAISPQ  360
SSVNNSVSNP TLGKHSRDGN IIASSNSQRE MHDMEHNSSE HNALIPKTLR IDDPREAAKS  420
SISMWSKLGI KNDDKASSGG LFKAFPSSKG NDINHQMVEA SSPVLQANPA ALSRSLTFRE  480
QT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003556733.10.0PREDICTED: cyclic dof factor 1-like
TrEMBLA0A0B2R5B80.0A0A0B2R5B8_GLYSO; Dof zinc finger protein DOF5.2
TrEMBLK7N1760.0K7N176_SOYBN; Uncharacterized protein
STRINGGLYMA20G04600.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62534147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.23e-77cycling DOF factor 2
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]