PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN28731.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB_related
Protein Properties Length: 134aa    MW: 15262.1 Da    PI: 10.0665
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN28731.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.91.2e-132367347
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rWT+eE+ +++++v+++G+ + + Ia+ +  ++t+ q+ s+ qky
       KHN28731.1 23 RWTEEEHRQFLRGVEEYGKSNLTDIAKNVVVTKTPAQVASHAQKY 67
                     9*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.4661672IPR017930Myb domain
SuperFamilySSF466896.13E-161873IPR009057Homeodomain-like
SMARTSM007175.0E-102070IPR001005SANT/Myb domain
TIGRFAMsTIGR015571.2E-152271IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.6E-82267IPR009057Homeodomain-like
PfamPF002495.6E-122367IPR001005SANT/Myb domain
CDDcd001675.91E-102368No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 134 aa     Download sequence    Send to blast
MAKNRENAAA GANPIHEKRK YTRWTEEEHR QFLRGVEEYG KSNLTDIAKN VVVTKTPAQV  60
ASHAQKYFLR QKSGKRTRPS IHDTEPVVAQ PQNIHDREPV VAQPHNAELP EHPIQQGLNP  120
PNNIITNDFL ANFK
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN28731.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006596269.17e-96transcription factor DIVARICATA
RefseqXP_028200022.17e-96transcription factor DIVARICATA-like
TrEMBLA0A0B2R3K82e-94A0A0B2R3K8_GLYSO; Myb-like protein J
STRINGGLYMA14G38311.11e-72(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13860414
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.12e-24MYB family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]