PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN28509.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB_related
Protein Properties Length: 88aa    MW: 10265.9 Da    PI: 10.4579
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN28509.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding28.43.7e-092381047
                     HHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding 10 ellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     el+  + +++G+g+Wk I+r +  +R + q+ s+ qky
       KHN28509.1  2 ELFMLGLQKYGKGDWKNISRIIK-TRNPTQVASHVQKY 38
                     789999****************9.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.872143IPR017930Myb domain
SuperFamilySSF466893.59E-10243IPR009057Homeodomain-like
PfamPF002491.3E-6238IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-5237IPR009057Homeodomain-like
CDDcd001671.50E-6239No hitNo description
TIGRFAMsTIGR015576.4E-10340IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 88 aa     Download sequence    Send to blast
MELFMLGLQK YGKGDWKNIS RIIKTRNPTQ VASHVQKYFL LQASSNKGKR RSIHDMVLPD  60
GPVPHRIYQQ NEVSFPNLYV PITHHIDH
Functional Description ? help Back to Top
Source Description
UniProtInvolved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN28509.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010418602.12e-20PREDICTED: transcription factor DIVARICATA-like
RefseqXP_027908514.11e-20transcription factor DIVARICATA-like
SwissprotQ8S9H71e-17DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0B2R8L52e-59A0A0B2R8L5_GLYSO; Transcription factor MYB1R1
STRINGXP_010418602.18e-20(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13860414
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58900.18e-21Homeodomain-like transcriptional regulator
Publications ? help Back to Top
  1. Galego L,Almeida J
    Role of DIVARICATA in the control of dorsoventral asymmetry in Antirrhinum flowers.
    Genes Dev., 2002. 16(7): p. 880-91
    [PMID:11937495]
  2. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]
  3. Almeida J,Rocheta M,Galego L
    Genetic control of flower shape in Antirrhinum majus.
    Development, 1997. 124(7): p. 1387-92
    [PMID:9118809]