PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN28490.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family G2-like
Protein Properties Length: 92aa    MW: 10309.1 Da    PI: 10.2792
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN28490.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like91.47.9e-293484151
     G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51
                kprl+Wtp+LHerF+eav++LGG +kAtPk +l+lm+++ Ltl+h+kSHLQ
  KHN28490.1 34 KPRLKWTPDLHERFIEAVNELGGVDKATPKIVLKLMGIPRLTLYHLKSHLQ 84
                79************************************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.2423191IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.0E-263284IPR009057Homeodomain-like
SuperFamilySSF466892.33E-133386IPR009057Homeodomain-like
TIGRFAMsTIGR015574.4E-213486IPR006447Myb domain, plants
PfamPF002491.8E-83685IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 92 aa     Download sequence    Send to blast
MHALRMHSPT ERHMMMQGGN GSGDSGLVLS TDAKPRLKWT PDLHERFIEA VNELGGVDKA  60
TPKIVLKLMG IPRLTLYHLK SHLQVTLFQL PI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150447e-66AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006574747.19e-52PREDICTED: uncharacterized protein LOC100786282 isoform X1
RefseqXP_006574748.19e-52PREDICTED: uncharacterized protein LOC100786282 isoform X2
SwissprotQ9SAK51e-26APL_ARATH; Myb family transcription factor APL
TrEMBLA0A0B2R4991e-62A0A0B2R499_GLYSO; Myb family transcription factor APL
STRINGGLYMA19G05385.14e-61(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38523163
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04030.13e-40G2-like family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]