PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN28241.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family ARF
Protein Properties Length: 651aa    MW: 72412 Da    PI: 7.0366
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN28241.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B382.34.8e-26110211199
                 EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..E CS
          B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelv 93 
                 f k+ltpsd++++g +++pkk+a+e+       ++++  ++++ +d++g +W++++iyr++++r++lt+GW+ Fv+a++L +gD+++F   + +++el+
  KHN28241.1 110 FSKILTPSDTSTHGGFSVPKKYADECfppldmTLQTPA-QEIVAKDLNGFEWRFRHIYRGQPKRHLLTSGWSLFVNAKKLVAGDSCIFV--RGESGELR 205
                 88****************************98555444.59************************************************..44999*** PP

                 EEEE-S CS
          B3  94 vkvfrk 99 
                 v+++r+
  KHN28241.1 206 VGIRRA 211
                 ****96 PP

2Auxin_resp74.33.4e-25238319183
  Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                 a++a+ ++++F v+Y+P++ + eF+v+++ ++k++ + + +G+R++m+ e e+s +r l+Gt++g +d+d++rWp+S Wr Lk
  KHN28241.1 238 ASNAVGNRTMFLVYYRPWTNPFEFIVHLQTYLKSTLQDYPIGTRVQMQHEVEESLRR-LAGTIIGNEDIDSIRWPGSAWRRLK 319
                 678999**********************************************98765.5*********************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.7E-3697234IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.103.3E-39104221IPR015300DNA-binding pseudobarrel domain
CDDcd100171.40E-25109210No hitNo description
SMARTSM010191.5E-27110212IPR003340B3 DNA binding domain
PfamPF023624.8E-24110211IPR003340B3 DNA binding domain
PROSITE profilePS5086314.015110212IPR003340B3 DNA binding domain
PfamPF065072.5E-24238319IPR010525Auxin response factor
PROSITE profilePS5174516.087555637IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 651 aa     Download sequence    Send to blast
LYTELWRACA GSFVYVPRVD DRVFYFPQGH LEQVAAYTQN QPDSHLEIPV YDLPSKILCK  60
IMNVELKAEA YSDEVYAQVT LVPEVQKDNL CFEEEVNIDQ IPSRNAAYSF SKILTPSDTS  120
THGGFSVPKK YADECFPPLD MTLQTPAQEI VAKDLNGFEW RFRHIYRGQP KRHLLTSGWS  180
LFVNAKKLVA GDSCIFVRGE SGELRVGIRR AAENLSNISQ SSSLISGHSM QLGILTNASN  240
AVGNRTMFLV YYRPWTNPFE FIVHLQTYLK STLQDYPIGT RVQMQHEVEE SLRRLAGTII  300
GNEDIDSIRW PGSAWRRLKV QWDAIVEDKM HPERVCPWWI EPLESAKEKK QVPALPTKKK  360
GHALLNQRSL PGISGFGKND VHQNSAGPSS QTRRADGDLQ GQDYSGLSPP QPLQRAPSTD  420
IIRPSKVPIR GSRFGKENRN QHPFLKQDPL HKSLGRSMSL THEDLSITSS NLTSIGSESL  480
GMPSTESRDE NDAPFGQPGS SSTFKLFGVN LIDSSPEIPS VNFVDLNKTS SLPSSPPMGV  540
APGKTCKKCR CVNNRSCTKV LKLGNALGRA VDLARFNGYT ELIAELDSMF DFQGTLISGG  600
SGWHVTCLDD EGDMMQLGDY PWQDFLGVVQ KMIICPKEGT DNLKPGSSAN P
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-114134519357Auxin response factor 1
4ldw_A1e-114134519357Auxin response factor 1
4ldw_B1e-114134519357Auxin response factor 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN28241.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028226185.10.0auxin response factor 23-like
TrEMBLA0A0B2R2I40.0A0A0B2R2I4_GLYSO; Auxin response factor (Fragment)
TrEMBLA0A445LEU60.0A0A445LEU6_GLYSO; Auxin response factor
STRINGGLYMA03G36710.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF131052329
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.21e-133auxin response factor 9
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]