PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN28216.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family HB-other
Protein Properties Length: 1051aa    MW: 117018 Da    PI: 9.1387
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN28216.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox21.44.4e-0769125157
                 TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
    Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                 +r+R  ++++ ++ ++++F  +  +s++e +e+++ lg+t +qV+ +F  +R + ++
  KHN28216.1  69 KRPRDLLNPKAVNYMQSVFSIKDAISKKELREISALLGVTVTQVRDFFNAQRSRVRR 125
                 799**************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.20366126IPR001356Homeobox domain
SMARTSM003892.3E-668130IPR001356Homeobox domain
SuperFamilySSF466898.55E-768132IPR009057Homeodomain-like
PfamPF000461.4E-469125IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.607.5E-669130IPR009057Homeodomain-like
CDDcd000866.02E-669126No hitNo description
Gene3DG3DSA:1.20.930.101.7E-4225310IPR017923Transcription factor IIS, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006351Biological Processtranscription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1051 aa     Download sequence    Send to blast
MDAWNEDFSE LEIGSSTESF QKFLVSQREL FHSQIDQFQE IVVTQCKLTG VNPLSQEMAA  60
GALSIKIGKR PRDLLNPKAV NYMQSVFSIK DAISKKELRE ISALLGVTVT QVRDFFNAQR  120
SRVRRSVQLS RERVLSSNSC EEPHDDQINS DPMRPINPTP LNSAGLSNTE EASCSTQEVT  180
LSDLDDSDKQ FVDSIFSLMQ KEETFSGQEK LMEWILTIQN FSVLLWFLSR GGGMNLATWL  240
SKAAVEEQTS VLLLVLKVLC HLPLHKAVPM HISAILQSVN KLRFYRTSDI SNRARVLLSK  300
WSKLFARNHV IKKPNGVKTS SDGHKEMMLS RRQACILSLF CAQFVGTSFL NYCDLYFCSI  360
GQLMGSESWH SNIDVPEDIL ALSSECSNNF RKIGSPQGVK LLPPSLDDSN KKSTLGVSSS  420
QSRERRKVQL VEQPGQKSVS RSSQVTRAGP VSQGRPMSAD DIQKAKMRAL FMQSKYGKSG  480
SKESSETKID SPYKQPQTNP ASIAACSSKV PTPPKIEENE KPLLLASKAT NKLEASYSKP  540
KMDVKEPLWE KCKRVQIPWK TPAEVELKDT WRVGGGENSK EVEVQRNRNR RDKEIIYKTV  600
QEMPPNPKEP WDLEMDYDDT LTLEIPIEQL PDGDADIAIS PNHVATHSVQ GVASTSSTSV  660
ATAEPDLELL AVLLKNPELV FALTSGQGGS IPSEETVKLL DMIKSGGVNL GLSENTNGSY  720
GTSVKAPEKV EVSLPSPTPL SDPRTSGWSS EASKNPFSRQ SLAPDRITQK HTAVATTNLL  780
SQIPITVTTV RQQPTVVVPS SRHLTSISVS PYSLPQATNV IPEKPPPLGH VQTSSDVGLT  840
MKKNLITANA SSVNFTGTHS TLAMRGDGTN YVKPVPNLSV QHEGLSNSFP QPFMPPSPTP  900
SHSASQQQRH QHLAQEVHYT EPPYRNPGRS YPPQIEKSDH GSDNMWRVRQ DHVSSSYLSQ  960
RNHNNNYNTI VGGSRQSGFY DRNNHARGEF ESWSPENSPT RNPRYAPGRN YPESRMNHGR  1020
NHRPEWSRQR GSSGHWDPGR QGNRKWHDQR R
Functional Description ? help Back to Top
Source Description
UniProtSeems to play a role in the regulation of flowering time in the autonomous flowering pathway by repressing FLOWERING LOCUS C expression. {ECO:0000269|PubMed:10363371}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN28216.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2353490.0AC235349.1 Glycine max strain Williams 82 clone GM_WBb0092H01, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028226223.10.0homeobox protein LUMINIDEPENDENS-like
SwissprotQ387961e-163LUMI_ARATH; Homeobox protein LUMINIDEPENDENS
TrEMBLA0A0B2R2D80.0A0A0B2R2D8_GLYSO; Homeobox protein LUMINIDEPENDENS
STRINGGLYMA03G36970.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF98092934
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02560.21e-136HB-other family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]
  2. Chakrabortee S, et al.
    Luminidependens (LD) is an Arabidopsis protein with prion behavior.
    Proc. Natl. Acad. Sci. U.S.A., 2016. 113(21): p. 6065-70
    [PMID:27114519]