PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN27990.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GRAS
Protein Properties Length: 386aa    MW: 43304.6 Da    PI: 5.977
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN27990.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS430.71.2e-131153841373
        GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaN 99 
                 l++lL++cA+a+s+++++  ++l+ r ++ +s +g+p+qRl ay++e+L ar + s++++y+al+++e +    +e l++++l++e++P+lkf++++aN
  KHN27990.1  15 LKQLLIACAKALSENNMNDFDQLVGRAKDAVSINGEPIQRLGAYMVEGLVARTQASGNSIYHALRCKEPE---GDELLTYMQLLFEICPYLKFGYMAAN 110
                 689******************************************************************9...9************************* PP

        GRAS 100 qaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrv 196
                  aI ea  +e+r+HiiDf+i qG+QW++LlqaLa+Rp+g+p++RiTg+++p s+  + +  e +g+rLa + e++g+p+ef+  v     d++ e+L++
  KHN27990.1 111 GAIAEACRNEDRIHIIDFQIAQGTQWMTLLQALAARPGGAPHVRITGIDDPVSKyaRGDGPEVVGKRLALMSEKFGIPVEFHG-VPVFAPDVTREMLDI 208
                 ***************************************************99999999************************.688899********* PP

        GRAS 197 kpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreiv 295
                 +pgEalaVn+ lqlh++ desv+++++rd +L+lv+slsPkv ++veqe+++n+++F++rf+e+l+yy a+f+s++++lpr+s+eri+vE+++l+r+iv
  KHN27990.1 209 RPGEALAVNFPLQLHHTADESVHVSNPRDGLLRLVRSLSPKVTTLVEQESNTNTTPFFNRFIETLDYYLAIFESIDVTLPRDSKERINVEQHCLARDIV 307
                 *************************************************************************************************** PP

        GRAS 296 nvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                 n++aceg+er+erhe ++kW++rl++aGF++ pls+++++ +++llr ++ + y++ e++g+++lgWkdr+L+s+SaW
  KHN27990.1 308 NIIACEGKERVERHELFGKWKSRLKMAGFQQCPLSSYVNSVIRSLLRCYS-EHYTLVEKDGAMLLGWKDRNLISASAW 384
                 **********************************************9999.66************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098566.3461366IPR005202Transcription factor GRAS
PfamPF035144.0E-12915384IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 386 aa     Download sequence    Send to blast
MEEEATLEAF PPNNLKQLLI ACAKALSENN MNDFDQLVGR AKDAVSINGE PIQRLGAYMV  60
EGLVARTQAS GNSIYHALRC KEPEGDELLT YMQLLFEICP YLKFGYMAAN GAIAEACRNE  120
DRIHIIDFQI AQGTQWMTLL QALAARPGGA PHVRITGIDD PVSKYARGDG PEVVGKRLAL  180
MSEKFGIPVE FHGVPVFAPD VTREMLDIRP GEALAVNFPL QLHHTADESV HVSNPRDGLL  240
RLVRSLSPKV TTLVEQESNT NTTPFFNRFI ETLDYYLAIF ESIDVTLPRD SKERINVEQH  300
CLARDIVNII ACEGKERVER HELFGKWKSR LKMAGFQQCP LSSYVNSVIR SLLRCYSEHY  360
TLVEKDGAML LGWKDRNLIS ASAWHC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-62173856375GRAS family transcription factor containing p
Search in ModeBase