PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN27910.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family G2-like
Protein Properties Length: 441aa    MW: 48724.8 Da    PI: 6.3073
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN27910.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like87.61.1e-27170224156
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                 k +++WtpeLH+rFv+aveqL G +kA+P++ile+m++++Lt+++++SHLQkYR++
  KHN27910.1 170 KVKVDWTPELHRRFVQAVEQL-GVDKAVPSRILEIMGIDCLTRHNIASHLQKYRSH 224
                 5689*****************.********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.042167226IPR017930Myb domain
SuperFamilySSF466895.02E-18168227IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.7E-26168227IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-26170224IPR006447Myb domain, plants
PfamPF002491.4E-7173222IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010638Biological Processpositive regulation of organelle organization
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 441 aa     Download sequence    Send to blast
MLAVSPLRST RDEGQGEMME SFSIGTDDFA DLSEGNLLES INFDDLFMGI NDDEDVLPDL  60
EMDPEMLAEF SLSTEESDMA SSSVSVENNN KSADNNNNND GNNIVTTEKQ DEVIVIAANS  120
SSDSGSSRGE EIVSKSDESV VMNPSRKESE KGRKSSNHAA RNNNPQGKRK VKVDWTPELH  180
RRFVQAVEQL GVDKAVPSRI LEIMGIDCLT RHNIASHLQK YRSHRKHLLA REAEAARWSQ  240
RKQLLAAAGV GRGGGSKREV NPWLTPTMGF PPMTSMHHFR PLHVWGHQTM DQSFMHMWPK  300
HPPYLPSPPV WPPQTAPSPP APDPLYWHQH QRAPNAPTRG TPCFPQPLTT TRFGSQTVPG  360
IPPRHAMYQI LDPGIGIPAS QTPPRPLVDF HPSKESIDAA ISDVLSKPWL PLPLGLKAPA  420
LDGVMGELQR QGIPKIPPSY A
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-15167222257ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150405e-98AP015040.1 Vigna angularis var. angularis DNA, chromosome 7, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003540379.10.0PREDICTED: transcription activator GLK1-like
TrEMBLA0A0B2R2J40.0A0A0B2R2J4_GLYSO; Transcription activator GLK1
TrEMBLI1LUI90.0I1LUI9_SOYBN; Uncharacterized protein
STRINGGLYMA12G33430.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF42423461
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20570.13e-79GBF's pro-rich region-interacting factor 1
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]