PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN27541.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family LBD
Protein Properties Length: 164aa    MW: 18131.3 Da    PI: 6.7447
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN27541.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260143.18.8e-4510108199
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +CaaCk+lrrkC +dC++apyfp e+p+kfanvhk+FGasnv+kll+++++++reda++sl+yeAear++dPvyG+vg i+ lq+q+ +l++el+++ +
  KHN27541.1  10 PCAACKFLRRKCMPDCIFAPYFPPEEPQKFANVHKIFGASNVSKLLNEVQPHQREDAVNSLAYEAEARIKDPVYGCVGAISVLQRQVIRLQKELDATSA 108
                 7*********************************************************************************************98765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.7869110IPR004883Lateral organ boundaries, LOB
PfamPF031952.4E-4410106IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 164 aa     Download sequence    Send to blast
MASSSYSNSP CAACKFLRRK CMPDCIFAPY FPPEEPQKFA NVHKIFGASN VSKLLNEVQP  60
HQREDAVNSL AYEAEARIKD PVYGCVGAIS VLQRQVIRLQ KELDATSADL IRYTCNEMPT  120
TTQDGRRIIG EGGGSSLGQS SGYYYPSPWN NDTLGDGYHR GDNI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-6771188119LOB family transfactor Ramosa2.1
5ly0_B2e-6771188119LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN27541.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0908391e-161BT090839.1 Soybean clone JCVI-FLGm-5B3 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003548568.11e-122LOB domain-containing protein 25
RefseqXP_014624042.11e-122LOB domain-containing protein 25
RefseqXP_014624043.11e-122LOB domain-containing protein 25
RefseqXP_014624044.11e-122LOB domain-containing protein 25
RefseqXP_028206945.11e-122LOB domain-containing protein 25-like
RefseqXP_028206946.11e-122LOB domain-containing protein 25-like
SwissprotQ8L8Q31e-67LBD25_ARATH; LOB domain-containing protein 25
TrEMBLA0A0R0FV531e-120A0A0R0FV53_SOYBN; Uncharacterized protein
TrEMBLA0A0R0FVB01e-120A0A0R0FVB0_SOYBN; Uncharacterized protein
STRINGGLYMA16G07770.21e-121(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF109134112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27650.12e-70LOB domain-containing protein 25
Publications ? help Back to Top
  1. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]