PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN27456.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family LBD
Protein Properties Length: 170aa    MW: 18636.8 Da    PI: 7.468
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN27456.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260142.81.1e-4410108199
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +CaaCk+lrrkC +dC++apyfp e+p+kfanvhk+FGasnv+kll+++++++reda++sl+yeAear++dPvyG+vg i+ lq+q+ +l++el+++++
  KHN27456.1  10 PCAACKFLRRKCMPDCIFAPYFPPEEPHKFANVHKIFGASNVSKLLNEVQPHQREDAVNSLAYEAEARIKDPVYGCVGAISVLQKQVLRLQKELDATNA 108
                 7*********************************************************************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.9859110IPR004883Lateral organ boundaries, LOB
PfamPF031953.0E-4410107IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0004088Molecular Functioncarbamoyl-phosphate synthase (glutamine-hydrolyzing) activity
Sequence ? help Back to Top
Protein Sequence    Length: 170 aa     Download sequence    Send to blast
MASSSYSNSP CAACKFLRRK CMPDCIFAPY FPPEEPHKFA NVHKIFGASN VSKLLNEVQP  60
HQREDAVNSL AYEAEARIKD PVYGCVGAIS VLQKQVLRLQ KELDATNADL IRYSACNEIP  120
NTTTHHGGRR MSDDGGGGGS SLAHSHGFYY PSNWNNDPCG NSNGYPRGDI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-6471198119LOB family transfactor Ramosa2.1
5ly0_B2e-6471198119LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN27456.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150371e-121AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006579776.11e-126LOB domain-containing protein 25
RefseqXP_014630864.11e-126LOB domain-containing protein 25
RefseqXP_028231096.11e-126LOB domain-containing protein 25-like
RefseqXP_028231097.11e-126LOB domain-containing protein 25-like
SwissprotQ8L8Q35e-71LBD25_ARATH; LOB domain-containing protein 25
TrEMBLA0A445KHB71e-125A0A445KHB7_GLYSO; LOB domain-containing protein 25 isoform A
TrEMBLK7KNN71e-125K7KNN7_SOYBN; Uncharacterized protein
STRINGGLYMA05G08870.21e-126(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF109134112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27650.13e-71LOB domain-containing protein 25
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]
  2. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]