PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN27391.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family G2-like
Protein Properties Length: 428aa    MW: 46838.6 Da    PI: 7.4801
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN27391.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.55.3e-32248303156
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                 k+r++W+p+LH+rFv+a++ LGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  KHN27391.1 248 KARRCWSPDLHRRFVNALQMLGGSQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 303
                 68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.355245305IPR017930Myb domain
SuperFamilySSF466895.82E-17245306IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.8E-28246306IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-26248303IPR006447Myb domain, plants
PfamPF002497.3E-7250301IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 428 aa     Download sequence    Send to blast
MASPSELSLD CKPQSYSLLL KSFGDQTDHS YKLEEFLNRL EEERLKIDAF KRELPLCMQL  60
LTNAMEASRQ QLQAFKVNHG AKPVLEEFIP MKHLASESSE KATNMSDKAN WMTSAQLWSQ  120
ASSEGTKQQP PITTLKESDI GFSISPKLAL DNKQRNGGGA FLPFSKERNS CQGSTLRPLP  180
ELVLASAEKE MEDKKRAEVE IKGVSCQSRK ENSGSDGAVV DQGKGGSPVA SSHAQTTTTT  240
TSAQTHRKAR RCWSPDLHRR FVNALQMLGG SQVATPKQIR ELMKVDGLTN DEVKSHLQKY  300
RLHTRRPSPS PQAVGAAPQL VVLGGIWVPP EYATAAHTAT PTLYGAHPPL LPPPPPHHNA  360
LHHLHMYKAA PHGQGSPESD VPSNGERSES IEDGKSESSS WKGESGENEG ERKGIGEESN  420
GSEITLKF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-14248301255Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-14248301255Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A1e-14248301154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-14248301154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-14248301154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-14248301154Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-14248301255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-14248301255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-14248301255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-14248301255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-14248301255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-14248301255Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor acting as a flowering repressor, directly repressing FT expression in a dosage-dependent manner in the leaf vasculature. {ECO:0000269|PubMed:25132385}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN27391.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by SVP. Down-regulated by high temperature and gibberellic acid treatment. Not regulated by photoperiod, circadian rhythm under long days or vernalization. {ECO:0000269|PubMed:25132385}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003525655.10.0myb family transcription factor EFM
RefseqXP_028231187.10.0myb family transcription factor EFM-like
SwissprotQ9ZQ851e-123EFM_ARATH; Myb family transcription factor EFM
TrEMBLA0A445KIL40.0A0A445KIL4_GLYSO; Myb family transcription factor EFM
TrEMBLI1K1C40.0I1K1C4_SOYBN; Uncharacterized protein
STRINGGLYMA05G08150.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF54663455
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.11e-109G2-like family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]