PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN27228.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 368aa    MW: 39678.2 Da    PI: 9.7445
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN27228.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.94.5e-3872131261
      zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                 +++alkcprC+stntkfCyynnyslsqPr+fCk+CrryWt+GGalr vPvGgg+r+nk++
  KHN27228.1  72 PDAALKCPRCESTNTKFCYYNNYSLSQPRHFCKTCRRYWTRGGALRSVPVGGGCRRNKRN 131
                 68899****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-3056121IPR003851Zinc finger, Dof-type
PfamPF027011.4E-3274130IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.38576130IPR003851Zinc finger, Dof-type
PROSITE patternPS01361078114IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 368 aa     Download sequence    Send to blast
MVFPSLPIYL DPPNWSQQQP NQQAGIGTNN PQIPPPLQPS PPSSVTTGIG GQGSIRPGSM  60
ADRARMAKIH QPDAALKCPR CESTNTKFCY YNNYSLSQPR HFCKTCRRYW TRGGALRSVP  120
VGGGCRRNKR NKGNSARSKS PMKPSASANS SSSGCTPDHV MMTHLPTPIT PTQFPFLASL  180
HHYNGDYVSG GIGSHFGAIT TPLVARNNGN NTSDVEFQIG TSSASSLGNI SGGAMLSNNG  240
LGDQQWRFNN LQQVQHQFPF LSTNFEPQIG VFQFGGGENN NAEPPNYAKN GGRFDIRSKM  300
DSINSSVSGI VPQLNTIKLE ENQENQGLSL SKNLLMTSSG NGVLWNNGSS GNAWSEVPSF  360
IPSPNHLL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003520022.10.0PREDICTED: dof zinc finger protein DOF2.4-like isoform X1
TrEMBLA0A0B2R5J50.0A0A0B2R5J5_GLYSO; Dof zinc finger protein DOF3.6
STRINGGLYMA02G10250.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65634143
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37590.11e-36DNA binding with one finger 2.4
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]