PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN26927.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB_related
Protein Properties Length: 331aa    MW: 36821.8 Da    PI: 9.2535
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN26927.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.41.6e-1359103147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r +WT++E++++++a +++  + Wk+I + +g  +t  q++s+ qky
       KHN26927.1  59 RESWTEQEHDKFLEALQLFDRD-WKKIEAFVG-SKTVIQIRSHAQKY 103
                      789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.2E-1653109IPR009057Homeodomain-like
PROSITE profilePS5129415.40854108IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-657109IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-1857106IPR006447Myb domain, plants
SMARTSM007175.3E-1158106IPR001005SANT/Myb domain
PfamPF002492.7E-1159103IPR001005SANT/Myb domain
CDDcd001672.05E-861104No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MVSVNPSPAQ GFYFFDPSNM ALPGVNNLPP PPPPAPPSHA AVEDPSKKIR KPYTITKSRE  60
SWTEQEHDKF LEALQLFDRD WKKIEAFVGS KTVIQIRSHA QKYFLKVQKK GTSEHVPPPR  120
PKRKAARPYP QKAPKTPTVS QVMGPLQSSS SFIEPAYIYI PDSSSALGTP VTNMPSSSWN  180
YNNTPQPVNV PQVTRDDMGF TVAGQTAPLN CCCSSSNESN PPTWPSSKRI NQGDQEPIKV  240
MPDFAQVYSF IGSVFDPNST NHLQKLRQMD PLNVETILLL MRNLSINLMS PEFEDHKRML  300
SSYDTDSDKS KLVNICSKSL TNKSESAVLS A
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN26927.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028239502.10.0protein REVEILLE 5-like
RefseqXP_028239503.10.0protein REVEILLE 5-like
SwissprotC0SVG51e-106RVE5_ARATH; Protein REVEILLE 5
TrEMBLA0A0B2R4Z50.0A0A0B2R4Z5_GLYSO; Protein REVEILLE 5 isoform A
STRINGGLYMA07G07200.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11193396
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01280.18e-92MYB_related family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]
  2. Gray JA,Shalit-Kaneh A,Chu DN,Hsu PY,Harmer SL
    The REVEILLE Clock Genes Inhibit Growth of Juvenile and Adult Plants by Control of Cell Size.
    Plant Physiol., 2017. 173(4): p. 2308-2322
    [PMID:28254761]