PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN26894.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family YABBY
Protein Properties Length: 218aa    MW: 24255.2 Da    PI: 6.2999
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN26894.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY199.71.2e-6161632165
       YABBY   2 dvfssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakas....qllaaeshldeslkeelleelkveeenlksnvekeesastsv 96 
                 ++f+ +eq+CyvqC+fC+til+vsvP + l++vvtvrCGhCtsllsvn++kas    +lla+  hl+         +++ +++  ++   ++++as  +
  KHN26894.1   6 HLFDLPEQICYVQCGFCTTILMVSVPCSILSTVVTVRCGHCTSLLSVNMKKASfvpfHLLASLTHLE--------PKEGASDDGANKSLNSYNNASIIT 96 
                 7899**********************************************99977777777777743........333333333333344444444444 PP

       YABBY  97 sseklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPk 165
                 +++  +e++  ++++   v +PPekrqr Psaynrfikeei+r+k++nP+++h+eafs+aaknWa fP+
  KHN26894.1  97 TNSDCEEENVTQISN--VVHKPPEKRQRTPSAYNRFIKEEIKRLKSENPNMAHKEAFSTAAKNWANFPP 163
                 443333444444443..478************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046909.2E-6211164IPR006780YABBY protein
SuperFamilySSF470959.69E-10110165IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.102.1E-6114165IPR009071High mobility group box domain
CDDcd013901.73E-5122165No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 218 aa     Download sequence    Send to blast
MSTLNHLFDL PEQICYVQCG FCTTILMVSV PCSILSTVVT VRCGHCTSLL SVNMKKASFV  60
PFHLLASLTH LEPKEGASDD GANKSLNSYN NASIITTNSD CEEENVTQIS NVVHKPPEKR  120
QRTPSAYNRF IKEEIKRLKS ENPNMAHKEA FSTAAKNWAN FPPSQCDGEA DSCNGTEQLG  180
DLDSHEEPRD AIEVHKEGQG FRGRKAPRNS IWERAPFE
Functional Description ? help Back to Top
Source Description
UniProtEssential for the formation and the abaxial-adaxial asymmetric growth of the ovule outer integument. {ECO:0000269|PubMed:10601041, ECO:0000269|PubMed:12183380, ECO:0000269|PubMed:9093862, ECO:0000269|PubMed:9118807}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN26894.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Autoinduction down-regulated by SUP in adaxial region of the ovule outer integument. Negatively and spatially regulated by HLL, ANT, BELL1, NZZ/SPL and SUP. {ECO:0000269|PubMed:10601041, ECO:0000269|PubMed:12183380, ECO:0000269|PubMed:12183381}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025985248.11e-164axial regulator YABBY 4
RefseqXP_028245109.11e-164axial regulator YABBY 4
SwissprotQ9LDT31e-73YAB4_ARATH; Axial regulator YABBY 4
TrEMBLA0A0B2R3V01e-163A0A0B2R3V0_GLYSO; Axial regulator YABBY 4
TrEMBLK7L9I21e-163K7L9I2_SOYBN; Uncharacterized protein
STRINGGLYMA08G39290.21e-164(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61442852
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23420.16e-76YABBY family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]
  2. Lora J,Hormaza JI,Herrero M
    Transition from two to one integument in Prunus species: expression pattern of INNER NO OUTER (INO), ABERRANT TESTA SHAPE (ATS) and ETTIN (ETT).
    New Phytol., 2015. 208(2): p. 584-95
    [PMID:25991552]
  3. Skinner DJ,Brown RH,Kuzoff RK,Gasser CS
    Conservation of the role of INNER NO OUTER in development of unitegmic ovules of the Solanaceae despite a divergence in protein function.
    BMC Plant Biol., 2016. 16(1): p. 143
    [PMID:27350128]
  4. Simon MK,Skinner DJ,Gallagher TL,Gasser CS
    Integument Development in Arabidopsis Depends on Interaction of YABBY Protein INNER NO OUTER with Coactivators and Corepressors.
    Genetics, 2017. 207(4): p. 1489-1500
    [PMID:28971961]