PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN26845.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family LBD
Protein Properties Length: 105aa    MW: 11652.1 Da    PI: 4.9199
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN26845.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26042.51.9e-1314061100
      DUF260  61 lvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                 +vyeA+ar+rdPvyG+vg i++lqqq++ l+++lal+++e
  KHN26845.1   1 MVYEANARVRDPVYGCVGAISSLQQQVDVLQTQLALAQAE 40 
                 69*********************************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031955.8E-11138IPR004883Lateral organ boundaries, LOB
PROSITE profilePS508919.476141IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0004088Molecular Functioncarbamoyl-phosphate synthase (glutamine-hydrolyzing) activity
Sequence ? help Back to Top
Protein Sequence    Length: 105 aa     Download sequence    Send to blast
MVYEANARVR DPVYGCVGAI SSLQQQVDVL QTQLALAQAE VVHMRMRQFS PPSEQQQPSV  60
LPEASNSSSE NLYHSSRLLS SQTKSVFGMD MVVDQANMGQ SLWSY
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN26845.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0978641e-150BT097864.1 Soybean clone JCVI-FLGm-16M12 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028246177.16e-71LOB domain-containing protein 4-like
SwissprotQ9SHE91e-19LBD4_ARATH; LOB domain-containing protein 4
TrEMBLA0A445JFU01e-69A0A445JFU0_GLYSO; LOB domain-containing protein 4
STRINGGLYMA08G17990.17e-70(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF133434105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.12e-12LOB domain-containing protein 4
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]