PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN26432.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family EIL
Protein Properties Length: 760aa    MW: 84184.8 Da    PI: 6.5126
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN26432.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3362.48e-111294671353
                 XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
        EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraWWkekv 99 
                 eel+ rmw+d+mll++lk+++k+    ke       + ++ e +++k+  raQD +Lk Mlk+mevc ++GfvYgiip+kgkpv+gasd+Lr+WWke v
  KHN26432.1  29 EELETRMWRDRMLLRKLKDERKE----KE-------QGQTVEMMKKKALTRAQDIVLKNMLKMMEVCDVRGFVYGIIPDKGKPVSGASDNLRGWWKERV 116
                 8**************99888886....33.......3467899******************************************************** PP

                 XXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT--TT--.-----G CS
        EIN3 100 efdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelglskdqgtppykkp 198
                 +fdrngpaa+  y+ +    + +++  +   s+  +ls+l+DTtlgSLLs lmqhcdppqrr+pl+k v+pPWWPtG e ww+elg++ d g+ppy+kp
  KHN26432.1 117 KFDRNGPAAMLRYDEETGFDDLRNEF-SGDPSSAYRLSDLPDTTLGSLLSCLMQHCDPPQRRYPLDKNVPPPWWPTGLEIWWPELGFAVDPGPPPYRKP 214
                 *************9887776655555.55888999**************************************************************** PP

                 GG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXX..XX.....XXXXXXXXXXXXXXXXXXXX..... CS
        EIN3 199 hdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsah..ss.....slrkqspkvtlsceqkedve..... 285
                 hdlkk+wk  vLtavikh+sp+i++i++ +r s+ lqdk +ake++++++v+++ee +++++++h  +        ++  + + ++ +  + ++     
  KHN26432.1 215 HDLKKVWKQCVLTAVIKHISPDITKIKNMVRLSRTLQDKLTAKETAIWSAVVKREETLARRLHPHlfPAkpiirRPHHAIRGYDIEGSGARARNflggq 313
                 *****************************************************************8622343222222444445555555444477655 PP

                 .XXXXXX.XXXXXXXXXX................................................................................. CS
        EIN3 286 .gkkeskikhvqavktta................................................................................. 302
                   ++ + +++v a+++ +                                                                                 
  KHN26432.1 314 sSHNPPPTSNVAAHSN-Nsmllasgtarsflggqsshnpqptsnvgnggarnffggqnyppltsnvdsgdgrsflggqnnpppitsnvanginnnnsmv 411
                 4444444444444444.26******************************************************************************** PP

                 .........XXXXXXXXXXXXXXXXXXXXX......XXXXXXX.XXXXXXXXXXXXXXXX CS
        EIN3 303 .........gfpvvrkrkkkpsesakvsskevsrtcqssqfrgsetelifadknsisqne 353
                            + ++kr    +e + + + + ++ c+ssq++++et+++f+d+n +++++
  KHN26432.1 412 tmnngivlpPDHGANKR----KEVQGITIPHDTYSCHSSQCPYHETSFGFSDMNVRNNHQ 467
                 ***98765422233333....355555556668*************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048732.7E-10429270No hitNo description
Gene3DG3DSA:1.10.3180.101.4E-61147279IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167681.83E-53150273IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 760 aa     Download sequence    Send to blast
MIEEEEDEDE EEEDDDDDDN GQKKVLTIEE LETRMWRDRM LLRKLKDERK EKEQGQTVEM  60
MKKKALTRAQ DIVLKNMLKM MEVCDVRGFV YGIIPDKGKP VSGASDNLRG WWKERVKFDR  120
NGPAAMLRYD EETGFDDLRN EFSGDPSSAY RLSDLPDTTL GSLLSCLMQH CDPPQRRYPL  180
DKNVPPPWWP TGLEIWWPEL GFAVDPGPPP YRKPHDLKKV WKQCVLTAVI KHISPDITKI  240
KNMVRLSRTL QDKLTAKETA IWSAVVKREE TLARRLHPHL FPAKPIIRRP HHAIRGYDIE  300
GSGARARNFL GGQSSHNPPP TSNVAAHSNN SMLLASGTAR SFLGGQSSHN PQPTSNVGNG  360
GARNFFGGQN YPPLTSNVDS GDGRSFLGGQ NNPPPITSNV ANGINNNNSM VTMNNGIVLP  420
PDHGANKRKE VQGITIPHDT YSCHSSQCPY HETSFGFSDM NVRNNHQLAC IYNNGNNNNN  480
NIVQVVGGGG GGSSSSQLGP GNPKNNVNVA LGQSMHIAAP VVNQTQTQNL TIGQPRHSAA  540
PAVNNQNQTL NVISDNNNSG EIGSNGLMHN MNVVVPLGNQ NQQQVQNVLQ PQVVDSNNFY  600
GGGRVSLDKN NNNLFGNNSM NINSVPPLLV CQNMQQVQSV QPQVMDKNFF VGGRVSLDKN  660
NNNLFDNNMN TFPLLGSQNM QQVQNVHEPQ VMDKSTFFGE RVGGGYKLNN ADQVHGDFST  720
STSMDPSSYD QWDATNNSQS DFMDSPLLAA PSQDFLWLYN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A9e-591472781132Protein ETHYLENE INSENSITIVE 3
4zds_B9e-591472781132Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN26432.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1984460.0AC198446.7 Glycine max cultivar Williams 82 clone gmw2-129e12, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028237047.10.0probable basic-leucine zipper transcription factor J
TrEMBLA0A0B2R3G90.0A0A0B2R3G9_GLYSO; Protein ETHYLENE INSENSITIVE 3
STRINGGLYMA06G47181.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF32234200
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27050.11e-97ETHYLENE-INSENSITIVE3-like 1
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]