PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN26429.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family EIL
Protein Properties Length: 876aa    MW: 95929.3 Da    PI: 7.0705
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN26429.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3369.46.2e-113204581353
                 XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
        EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraWWkekv 99 
                 eel+krmw+dqmll++lk+++k+    ke       + ++ e +++k+  raQD +Lk Mlk+mevc ++GfvYgiip+kgkpv+gasd+Lr+WWke v
  KHN26429.1  20 EELEKRMWRDQMLLRKLKDERKE----KE-------QGQTVEMMKKKALTRAQDIVLKNMLKMMEVCDVRGFVYGIIPDKGKPVSGASDNLRGWWKERV 107
                 8**************99888886....33.......3467899******************************************************** PP

                 XXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT--TT--.-----G CS
        EIN3 100 efdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelglskdqgtppykkp 198
                 +fdrngpaa+  y+ +    + +++ +    s+  +ls+l+DTtlgSLLs lmqhcdppqrr+pl+kgv+pPWWPtG e ww+elg+++d g+ppy+kp
  KHN26429.1 108 KFDRNGPAAMLRYDEETGFDDLGNEFRG-DPSSAYRLSDLPDTTLGSLLSCLMQHCDPPQRRYPLDKGVPPPWWPTGFEIWWPELGFAADPGPPPYRKP 205
                 *************999988887777755.778899**************************************************************** PP

                 GG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXX..XX.....XXXXXXXXXXXXXXXXXXXX..... CS
        EIN3 199 hdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsah..ss.....slrkqspkvtlsceqkedve..... 285
                 hdlkk+wk+ vLtavikh+sp+i++i++ +r s+ lqdk +ake++++++v+++ee +++++++h  +        ++  + + ++ +  + ++     
  KHN26429.1 206 HDLKKVWKLCVLTAVIKHISPDITKIKNIVRLSRTLQDKLTAKETAIWSAVVKREETLARRLHPHlfPAkpiirRPHHAIRGYDIEGSGARARNflggq 304
                 *****************************************************************8622343222222444445555555444477655 PP

                 .XXXXXX.XXXXXXXXXX................................................................................. CS
        EIN3 286 .gkkeskikhvqavktta................................................................................. 302
                   ++ + +++v a+++ +                                                                                 
  KHN26429.1 305 sSHNPPPTSNVAAHSN-Nsmllasgtarnflgglsshnpqptsnvgnggarnfiggqnypplnsnvdngdgrsflggqnnpppitsnfangisndnsmv 402
                 4444444444444444.26******************************************************************************** PP

                 .........XXXXXXXXXXXXXXXXXXXXX......XXXXXXX.XXXXXXXXXXXXXXXX CS
        EIN3 303 .........gfpvvrkrkkkpsesakvsskevsrtcqssqfrgsetelifadknsisqne 353
                            + ++kr    +e + + + + ++ c+s q++++et+++f+d+n +++++
  KHN26429.1 403 tmnngivlpPDHGANKR----KEVQGITIPHETYSCHSPQCPYNETSFGFSDMNVRNNHQ 458
                 ***98765422223333....355555666668*************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048731.3E-10620261No hitNo description
Gene3DG3DSA:1.10.3180.101.3E-62139270IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167686.28E-54141264IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 876 aa     Download sequence    Send to blast
MIEEEEDDDH NGEKQVLTIE ELEKRMWRDQ MLLRKLKDER KEKEQGQTVE MMKKKALTRA  60
QDIVLKNMLK MMEVCDVRGF VYGIIPDKGK PVSGASDNLR GWWKERVKFD RNGPAAMLRY  120
DEETGFDDLG NEFRGDPSSA YRLSDLPDTT LGSLLSCLMQ HCDPPQRRYP LDKGVPPPWW  180
PTGFEIWWPE LGFAADPGPP PYRKPHDLKK VWKLCVLTAV IKHISPDITK IKNIVRLSRT  240
LQDKLTAKET AIWSAVVKRE ETLARRLHPH LFPAKPIIRR PHHAIRGYDI EGSGARARNF  300
LGGQSSHNPP PTSNVAAHSN NSMLLASGTA RNFLGGLSSH NPQPTSNVGN GGARNFIGGQ  360
NYPPLNSNVD NGDGRSFLGG QNNPPPITSN FANGISNDNS MVTMNNGIVL PPDHGANKRK  420
EVQGITIPHE TYSCHSPQCP YNETSFGFSD MNVRNNHQLA CIYNNGNNNH NNAVQVVGGD  480
GGGSSSSQLG RGNPKNNVNV ALGQSMHTSA PVVNQSQTQN LTIGQPMNIS APVVSQNQSL  540
TIGQPMNISA PVVSQNQSLT IGQPMNISAP VVSQNQSLTI GQPMNISAPV VSQNQSLTIG  600
QPMNISAPVV SQNQSLTTIG QPMNISGPVV SQNQSLTIGQ PMSISAPVAS QNQSLTIGQP  660
PAVNNQNQTL NVISDNNNSG EIGSNGLMHN MNVVVPLGNQ NQQQVQNVLQ PQVVDSNNFF  720
GGGRVSLDKN NNNLFGNNNM NINSVPPLLA SQNMQQMQSV QPQVLDKNFF VGGRVSLDKN  780
NNNLFDNNMN NFPPLGSQNM QQLQNVHEPQ VMDKSTFFGE RIGGGYKLNN ADQVHGDFST  840
STDPSSYDQW DATNNSQSDF MDSPLLTAPS QDFLWL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A8e-591382691132Protein ETHYLENE INSENSITIVE 3
4zds_B8e-591382691132Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN26429.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1984460.0AC198446.7 Glycine max cultivar Williams 82 clone gmw2-129e12, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014632594.20.0signal transducer and activator of transcription B-like
TrEMBLA0A0B2R2F30.0A0A0B2R2F3_GLYSO; ETHYLENE INSENSITIVE 3-like 1 protein
STRINGGLYMA06G47181.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF32234200
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27050.11e-103ETHYLENE-INSENSITIVE3-like 1
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]